FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 991

FusionGeneSummary for AFAP1_NTRK2

check button Fusion gene summary
Fusion gene informationFusion gene name: AFAP1_NTRK2
Fusion gene ID: 991
HgeneTgene
Gene symbol

AFAP1

NTRK2

Gene ID

60312

4915

Gene nameactin filament associated protein 1neurotrophic receptor tyrosine kinase 2
SynonymsAFAP|AFAP-110|AFAP110EIEE58|GP145-TrkB|OBHD|TRKB|trk-B
Cytomap

4p16.1

9q21.33

Type of geneprotein-codingprotein-coding
Descriptionactin filament-associated protein 1110 kDa actin filament-associated proteinactin filament-associated protein, 110 kDaBDNF/NT-3 growth factors receptorBDNF-tropomyosine receptor kinase Bneurotrophic tyrosine kinase receptor type 2tropomyosin-related kinase Btyrosine kinase receptor B
Modification date2018051920180523
UniProtAcc

Q8N556

Q16620

Ensembl transtripts involved in fusion geneENST00000360265, ENST00000358461, 
ENST00000420658, ENST00000382543, 
ENST00000513842, 
ENST00000376214, 
ENST00000376213, ENST00000395882, 
ENST00000304053, ENST00000376208, 
ENST00000277120, ENST00000323115, 
ENST00000359847, ENST00000395866, 
Fusion gene scores* DoF score8 X 10 X 6=4805 X 4 X 4=80
# samples 125
** MAII scorelog2(12/480*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AFAP1 [Title/Abstract] AND NTRK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7680-01AAFAP1chr4

7780489

-NTRK2chr9

87356807

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360265ENST00000376214AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000376213AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000395882AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000304053AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000376208AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000277120AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000323115AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000359847AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000360265ENST00000395866AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000376214AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000376213AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000395882AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000304053AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000376208AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000277120AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000323115AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000359847AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000358461ENST00000395866AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000376214AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000376213AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000395882AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000304053AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000376208AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000277120AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000323115AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000359847AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000420658ENST00000395866AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000376214AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000376213AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000395882AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000304053AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000376208AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000277120AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000323115AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000359847AFAP1chr4

7780489

-NTRK2chr9

87356807

+
In-frameENST00000382543ENST00000395866AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000376214AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000376213AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000395882AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000304053AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000376208AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000277120AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000323115AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000359847AFAP1chr4

7780489

-NTRK2chr9

87356807

+
5UTR-3CDSENST00000513842ENST00000395866AFAP1chr4

7780489

-NTRK2chr9

87356807

+

Top

FusionProtFeatures for AFAP1_NTRK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFAP1

Q8N556

NTRK2

Q16620

Can cross-link actin filaments into both network andbundle structures (By similarity). May modulate changes in actinfilament integrity and induce lamellipodia formation. May functionas an adapter molecule that links other proteins, such as SRC andPKC to the actin cytoskeleton. Seems to play a role in thedevelopment and progression of prostate adenocarcinoma byregulating cell-matrix adhesions and migration in the cancercells. {ECO:0000250, ECO:0000269|PubMed:15485829}. Receptor tyrosine kinase involved in the development andthe maturation of the central and the peripheral nervous systemsthrough regulation of neuron survival, proliferation, migration,differentiation, and synapse formation and plasticity. Receptorfor BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is lessefficient in activating the receptor but regulates neuron survivalthrough NTRK2. Upon ligand-binding, undergoes homodimerization,autophosphorylation and activation. Recruits, phosphorylatesand/or activates several downstream effectors including SHC1,FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlappingsignaling cascades. Through SHC1, FRS2, SH2B1, SH2B2 activates theGRB2-Ras-MAPK cascade that regulates for instance neuronaldifferentiation including neurite outgrowth. Through the sameeffectors controls the Ras-PI3 kinase-AKT1 signaling cascade thatmainly regulates growth and survival. Through PLCG1 and thedownstream protein kinase C-regulated pathways controls synapticplasticity. Thereby, plays a role in learning and memory byregulating both short term synaptic function and long-termpotentiation. PLCG1 also leads to NF-Kappa-B activation and thetranscription of genes involved in cell survival. Hence, it isable to suppress anoikis, the apoptosis resulting from loss ofcell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells and mediatecommunication between neurons and glia.{ECO:0000269|PubMed:15494731}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-131760_106548731Compositional biasNote=Pro-rich
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-121660_106548731Compositional biasNote=Pro-rich
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-131760_106632815Compositional biasNote=Pro-rich
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-141860_106632815Compositional biasNote=Pro-rich
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-1317153_249548731DomainPH 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-1317347_441548731DomainPH 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-1216153_249548731DomainPH 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-1216347_441548731DomainPH 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-1317153_249632815DomainPH 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-1317347_441632815DomainPH 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-1418153_249632815DomainPH 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-1418347_441632815DomainPH 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-1317451_456548731MotifSH2-binding 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-131771_74548731MotifSH3-binding
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-131794_97548731MotifSH2-binding 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-1216451_456548731MotifSH2-binding 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-121671_74548731MotifSH3-binding
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-121694_97548731MotifSH2-binding 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-1317451_456632815MotifSH2-binding 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-131771_74632815MotifSH3-binding
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-131794_97632815MotifSH2-binding 1
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-1418451_456632815MotifSH2-binding 2
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-141871_74632815MotifSH3-binding
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-141894_97632815MotifSH2-binding 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819538_807386839DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815538_807386554DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717538_807386823DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712538_807386478DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814538_807386538DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020538_807386823DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021538_807386839DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712295_365230322DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712538_807230322DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813538_807386478DomainProtein kinase
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819544_552386839Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815544_552386554Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717544_552386823Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712544_552386478Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814544_552386538Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020544_552386823Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021544_552386839Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712544_552230322Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813544_552386478Nucleotide bindingATP
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819455_822386839Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815455_822386554Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717455_822386823Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712455_822386478Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814455_822386538Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020455_822386823Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021455_822386839Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712455_822230322Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813455_822386478Topological domainCytoplasmic
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819431_454386839TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815431_454386554TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717431_454386823TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712431_454386478TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814431_454386538TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020431_454386823TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021431_454386839TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712431_454230322TransmembraneHelical
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813431_454386478TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-1317557_648548731Coiled coilOntology_term=ECO:0000255
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-1216557_648548731Coiled coilOntology_term=ECO:0000255
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-1317557_648632815Coiled coilOntology_term=ECO:0000255
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-1418557_648632815Coiled coilOntology_term=ECO:0000255
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819148_196386839DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819197_282386839DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819295_365386839DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+81932_61386839DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815148_196386554DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815197_282386554DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815295_365386554DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+81532_61386554DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717148_196386823DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717197_282386823DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717295_365386823DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+71732_61386823DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712148_196386478DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712197_282386478DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712295_365386478DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+71232_61386478DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814148_196386538DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814197_282386538DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814295_365386538DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+81432_61386538DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020148_196386823DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020197_282386823DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020295_365386823DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+102032_61386823DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021148_196386839DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021197_282386839DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021295_365386839DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+102132_61386839DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712148_196230322DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712197_282230322DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+71232_61230322DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813148_196386478DomainNote=LRRCT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813197_282386478DomainNote=Ig-like C2-type 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813295_365386478DomainNote=Ig-like C2-type 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+81332_61386478DomainNote=LRRNT
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+819116_137386839RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+81992_113386839RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+815116_137386554RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+81592_113386554RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+717116_137386823RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+71792_113386823RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+712116_137386478RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+71292_113386478RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+814116_137386538RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+81492_113386538RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+1020116_137386823RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+102092_113386823RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+1021116_137386839RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+102192_113386839RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+712116_137230322RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+71292_113230322RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+813116_137386478RepeatNote=LRR 2
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+81392_113386478RepeatNote=LRR 1
TgeneNTRK2chr4:7780489chr9:87356807ENST00000277120+81932_430386839Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000304053+81532_430386554Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000323115+71732_430386823Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000359847+71232_430386478Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376208+81432_430386538Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376213+102032_430386823Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000376214+102132_430386839Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395866+71232_430230322Topological domainExtracellular
TgeneNTRK2chr4:7780489chr9:87356807ENST00000395882+81332_430386478Topological domainExtracellular


Top

FusionGeneSequence for AFAP1_NTRK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_1001aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS
WFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKR
ELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAH
GPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPP
ESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAK

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_985aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA
SVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECT
NLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTEL
TQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWS

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_716aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_700aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_1001aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS
WFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKR
ELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAH
GPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPP
ESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAK

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_985aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA
SVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECT
NLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTEL
TQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWS

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_1001aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS
WFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKR
ELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAH
GPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPP
ESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAK

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_985aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA
SVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECT
NLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTEL
TQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWS

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_716aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_700aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_1001aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFS
WFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKR
ELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAH
GPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPP
ESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAK

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_985aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPA
SVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECT
NLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTEL
TQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWS

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_640aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_1085aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK
VKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_1069aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND
DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQ
DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQML
HIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLW

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_800aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_784aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_1085aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK
VKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_1069aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND
DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQ
DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQML
HIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLW

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_1085aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK
VKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_1069aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND
DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQ
DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQML
HIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLW

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_800aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_784aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_1085aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGK
VKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_1069aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISND
DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQ
DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQML
HIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLW

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_724aa
MEELIVELRLFLELLDHETLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLP
EGTTEEAVPLSPGKAPEYITSNTDSDAMSSSTESTDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCTKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKA
ELEKKLSSERPSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGTLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
TDYIDVEMSASVIQTAKQTFCFMNRRVISANPTLGGTSNGTAHPSGTALHTDDVPCINGSWEPEDGFPASCSRGLGEEVLTDNAGLYDNL
PPPHIFARYSPADRKASRLSADKLSSNHYKYPASAQSVTNTSSVGRASLGLNSQLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRT
GSSANPNTPDVITEDTGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVTAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_3003nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA
AATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGG
GAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAG
ACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAG
TTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACAC
GGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCG
GGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATC
GGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCA
GAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAG
CCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTG
TATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_2955nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA
TTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTAT
AACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAG
GCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAG
TACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTG
ACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCC
ACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGG
GTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGC
CTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAG
GGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_2148nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_2100nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_3003nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA
AATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGG
GAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAG
ACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAG
TTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACAC
GGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCG
GGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATC
GGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCA
GAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAG
CCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTG
TATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_2955nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA
TTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTAT
AACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAG
GCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAG
TACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTG
ACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCC
ACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGG
GTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGC
CTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAG
GGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_3003nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA
AATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGG
GAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAG
ACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAG
TTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACAC
GGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCG
GGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATC
GGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCA
GAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAG
CCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTG
TATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAG

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_2955nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA
TTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTAT
AACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAG
GCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAG
TACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTG
ACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCC
ACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGG
GTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGC
CTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAG
GGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAG

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_2148nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_2100nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_3003nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCA
TGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCAT
CACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAA
AATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGG
GAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAG
ACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAG
TTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACAC
GGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCG
GGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATC
GGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCA
GAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAG
CCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTG
TATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAG

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_2955nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCC
TCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCA
GATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACA
TTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTAT
AACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAG
GCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAG
TACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTG
ACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCC
ACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGG
GTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGC
CTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAG
GGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAG

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_1920nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
CTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCG
GCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGG
GACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTG
ATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_3255nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_3207nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAG
CGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAG
GACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAAC
CTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGAC
CTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTG
CATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTC
GGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATG
CTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGG
GAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGA
CCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCAT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_2400nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_2352nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCC

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_3255nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_3207nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAG
CGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAG
GACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAAC
CTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGAC
CTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTG
CATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTC
GGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATG
CTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGG
GAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGA
CCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCAT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_3255nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_3207nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAG
CGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAG
GACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAAC
CTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGAC
CTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTG
CATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTC
GGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATG
CTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGG
GAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGA
CCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCAT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_2400nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_2352nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCC

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_3255nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAA
GTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_3207nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGAT
GATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGA
ATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAG
CGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAG
GACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAAC
CTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGAC
CTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTG
CATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTC
GGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATG
CTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGG
GAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGA
CCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCAT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2172nt
ATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTG
ATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCA
GCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCA
GAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGC
TCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTG
GTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAA
CTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGC
AAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGG
CTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCA
GAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAG
CAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTG
GGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGC
CGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATT
CCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTA
TTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCAC
TATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCT
AACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCG
TGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAACTTG
CCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTACAAA
TACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAGCCC
CCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACG
GGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGT
AATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGA
TTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_5391nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGG
TGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTC
GGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCT
CAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCT
AGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGA
CTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCAT
CATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCC
GCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCA
CCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCAC
TGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAG
CGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGA
GTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCC
CCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGG
CCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGC
TGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGT
ATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTT
TTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTT
AACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATG
AAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTT
ATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTAT
GGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTC
CCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTAC
TGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGAT
GGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTG
TCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAG
CTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTT
AACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTA
GAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGT
GGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATC
CCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTG
GGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTG
GCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCA
AATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCT
GTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTC
ATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTT
GAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_5343nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCC
ACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGT
CATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCT
GAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGC
AGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACAT
CGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAG
GGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGAT
CGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGT
GAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGAT
GCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGG
CAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCA
GGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTT
GGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTG
AGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCT
CTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTG
GTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATC
TGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCAC
AACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTG
TACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTAT
AAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATAT
GGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCG
GCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAG
CGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGA
TAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGG
GGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTC
ACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGT
GTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAAT
GGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCAT
CCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGT
TCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTT
TGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTG
TGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGA
AAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGAT
TGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCG
CCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAG
GAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_7282nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAA
ATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCC
CGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGT
GATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGT
AGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGAC
TTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAGTGCACACTGAATAGTCTAAT
CTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACTTTTTCATCTATAACACAGTGA
CTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTTCACTGTCAATAAAAGTCCAAA
TGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAAAACAAAACAAAACAAACAAAT
GAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCTATAGATTTAAGTTAGGCATAG
TCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTTGCCCTCTGCGATCCACCTGCT
TTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTTCTACTCTGAAAAGGCCTGGGA
GCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACTGTCATACTGCTGGGTTTTCAT
GGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATAATGTCCTTCTTCATTGCTGAG
AGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCACTTTAGCATCACAGTGACCTT
TGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCCACCCCACCCCACCCTGTTCCT
TTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGTTAGACATGCACACAGACGCCA
TAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAATTTAGCTTTAAGGTTCTATAG
ATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTAATAAACCAGGATCCATTTAGG
TACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAATACGTTATTGCTTGATGAAGA
CCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGCAGTTTCTCAAAAGCAGAAACA
TGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGGAGGTCCGAACATTTTCTGAAT
TCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGTGTTGATTTACAAAGAGGCCAG
CTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTATGGCAAAGGTTCTTGAGAATC
AGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGATTGTTTAAGAACTATTTTAAA
GTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCAAGGTAGATTTTTGTTTTAAAA
TGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATGAAAACAGCAGGCTATTAGAAA
ATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCTTCTCTTTTCTGTACTCTAGAC
CACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCATGTGTTGCATTATTGCAGCAT
TAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTCAATGCCAGGCAGGTCTCCTAA
ATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCAACTGTGTCCCACAGGAATGGG
AGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCCGATTGTTAAAAAGTTGGCTCA
ATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAAACATGATCATTGTTCTCTCAC
GGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGTTACCACAAGCTAAGAAACTGA
GTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTGTGACCCTCAGCTGTCTCCCTT
TGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAGAGACATCCTAGCAAATCCTTC
CTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCCAGGTTTAGATAGGAAAGTACA
TGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCAATGGGGGCCTCCAGAGACCCT
CTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGACAAAAGTACAAACAGTCTGAGG
CTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGGTTTTCTCTCCCAGTCTCCCAG
CAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAAACAATCCCAGCCCCACCCAGC
AACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGGCTGAGGCTTGGAGCATCTCCT
CAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAAAACCAGTTTCACGCCAGGTGC
GAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCACTTGACTTTTTTTTCTCTCTC
TCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAGAATTAGAACACACACGACTTT
TTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTTACACCTCCGCCTGTTTTGGTG
CTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCATCTTGTTTTGTCTAGACTCCAG
ATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCATCCAGCCACATGGGCAGGGCCA
GTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAATTAGTACAGAAGTAACCACTCT
ATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACATAGGGGAAGATTAAGGACTCT
TTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCAGCCCAGGAAAGTTCCATGACA
ATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAAAGAACGTCCCAGCCACCTGAT
TTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAGTGAGCACCCAGAATGTGTTGA
ACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAGCAAAAAGAAAGGAACAGAGAT
TTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAGATTCCTAAGAAACGCAAATCC
TTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATGCCCTGTTTTTTTTTTTTTTTT
CCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAAAATTTTTATTTTTAGTGCTGT

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_8464nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGG
TGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTC
GGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCT
CAAGCCAGACACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAG
GAGGCTAAATCCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTT
CCATAACCTAGCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCAAAGTACTATGCCACTTTAACT
ATAGACCCATCTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTA
GCTCGTTTAGACGTGTCTGAACACCACATCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGT
GTTGCTTTCCTTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCTGAAACAAACAAACAGAAACAA
AACATACTAACCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAAC
ACTATAGATGTCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAA
AATTGTCTCTAAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAG
GCATGTAAAGTATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATA
CTTCTCCAGCTATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTT
ACTAGGCAATTATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATT
AGCTAAAGCTATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTG
GAGGTGATATTTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGAGCAAAAATTCTGAATTACATC
CAGGACCCCAGAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACC
ATGGTCCATTTTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTT
TTGTCTTTCAAAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATG
GCCTGCACTTTAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGC
TTCTTTTATGGCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTT
CCCCCTCTCAGTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGC
TATCAAATAATGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAATTACATTTAAAATGTAAGCCA
TGTTATTATAAGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCT
GACCATTGGGTAATATTATTCTTTGTTATCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTC
CTAAGCTTGGTGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACT
CCCTCATCATCGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCT
AGAAGCATCCCAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGA
TGAATCCAATCAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAA
ACACAGTTGCAGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGA
GATGGCACCACCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATG
CAGCTTTTCTCTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTC
TCCTTCCTGGGGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTG
TTCTTCTTTCTCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAA
CCTGGTTGCCACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCC
CGAGGAGGAGATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTT
TCATTTTTAAAACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGAT
AGGATTGTCTTCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACC
TGGAAAACATAAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTGATATCGTTTGGATATATGGCT
TTCTAGTCTTGTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAAT
ATTTCTATAGTAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTG
TATTTCCTTGGAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCATATGGTAAGTATCACAGAGCAC
ATGAGGCCTGTGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCA
TCACTCCAGATAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCT
TTCAAAGAGCCGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATC
AAGGATACCTTGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGT
CCAGTGATCCCCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGA
GGCCTCTATCAATAGTATGACATCCAATAATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTT
CAAATGAATAAGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAAT
ATAATCCTAGTTTCTATATATTATTTTTATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTATGCTGTTACTATTAATTAACA
CATTTTTTAACCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCC
ATATTCCTAAATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCA
CTTTAGGGAATGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTT
TTCCTACAGGAATGATTACTTTTCAGATCCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTT
TTGCAAGTCATTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCT
ATTAATAGAGTACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCATAAACATCAATATCTTTACCCA
CATGATTTTTCCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCACATTTCTTCCTAGTTCCTAAT
TTCATTAGTGCCATTTCCTGATATCTACAGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTC
CAAGTGCTGTCAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACA
TGTGAGATTTTTGATTTCACTGAATTCTACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATAT
TGGTGATACATAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCA
CTCATGTCCTGAATCAATCACACTTTCCTTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAA
GTGGATCTTAGCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGA
GGATTCATGTCATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGC
TGGGTTGGGGGATTAGTTCATATGGTCCCCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTT
CCTCAAGGAAACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCC
TCCTACCAGGGCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAG
GGAAGGGGTTCTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGAGCGGACCTAACACATGACTTG
CATTCTCTTCCTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTGGAATTCTTTATCTATATGATC
TGTCCGAAAATGAGATCTTTTGTACTGGAATTTGTGATGTAGTTGATCATTCAGAGCCAAACGCATATACCAATAAAGACAAGACTGTCA

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_8416nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCC
ACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGT
CATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATA
ATTTGGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTG
CAAATTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGT
GCTCTAATGACTAACCCCTCAAAGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGA
GCTCAGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCACATCACCTGACAGCACGGGGTG
GTTTCCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAA
TGGAAACACACCTTCTGAGCTGAAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTT
GAAGGGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGT
AAATTAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATG
CCCTCTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCC
AATGAAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTG
TGTTTGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCT
GAGGAAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCA
CAGCCCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAA
CATTACTTTGAGTACACATGAGCAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAG
TTACCAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAAC
AATTGCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATA
ATGGCTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCAT
TAGGACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCA
TGGCACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGA
TATCATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGG
AAATGAATACATGCTGCATAATTACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTT
CAAGCACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTTATCAAAAGAGAAATATCACCC
AAGTATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTT
AGGTCAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATC
AGACATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTAT
TTCCCAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTC
TTGCATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACC
CAGGTGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACG
GCAGCTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCA
CCGTAGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTT
GTAGTGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCA
CGGCCAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAAC
TGGAAGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTG
TCAGTGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTC
AATCCCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGT
ATTTTAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCC
ACCAGTTAGAGTTAACCACTGATATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGA
CCATATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTG
TAGGAAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAG
CTGGCCACGTCAGACTCTCATATGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCT
CTTGTTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGAT
GATCACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACAT
CTCATACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTT
TGGTCACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTG
ATGTCTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAATAATATGTTAGTGTTGATATT
TTGCACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTC
AGAACCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTTTATTCATTACTGTATATGGGT
AGAGATCAATATTCTTTCTTATGCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACC
CAAGCTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATA
AAGCCCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAA
AATAAGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGATCCATTTATGTTTTCATGCTC
AATACTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCAC
TAACTGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCT
CTATCTTGGTTTTACTTCCATAAACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAG
GAACTATGATGCTAATGATCACATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTACAGAAACAATTATCAATACAT
GTAGCTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAG
GAGTCTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTCTACCTAGATTTTTATGGACAT
TGGATTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGG
GAGGGAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTCCTTCTCGGATTGTGTATATGC
TCTGCCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGT
TCTTGGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGA
GGAAGAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTCCCCATGCCATCTATTTACTTT
TGGAGAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACT
GTGATTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATT
CAGCCTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTC
TCCCACATTTCATGCAAGGGAGCGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGT
ATGAGTGACCAATGGAGCTTGGAATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTGGAATTTGTGATGTAGTTGATC

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_4295nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGG
TGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTC
GGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCT
CAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCT
AGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGA
CTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCAT
CATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCC
GCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCA
CCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCAC
TGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAG
CGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGA
GTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCC
CCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGG
CCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGC
TGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGT
ATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTT
TTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTT
AACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATG
AAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTT
ATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTAT
GGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTC
CCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTAC
TGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGAT
GGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_4076nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCC
ACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGT
CATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCT
GAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGC
AGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACAT
CGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAG
GGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGAT
CGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGT
GAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGAT
GCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGG
CAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCA
GGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTT
GGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTG
AGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCT
CTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTG
GTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATC
TGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCAC
AACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTG
TACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTAT
AAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATAT
GGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCG
GCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAG

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_7278nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAA
ATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCC
CGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGT
GATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGT
AGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGAC
TTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAGTGCACACTGAATAGTCTAAT
CTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACTTTTTCATCTATAACACAGTGA
CTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTTCACTGTCAATAAAAGTCCAAA
TGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAAAACAAAACAAAACAAACAAAT
GAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCTATAGATTTAAGTTAGGCATAG
TCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTTGCCCTCTGCGATCCACCTGCT
TTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTTCTACTCTGAAAAGGCCTGGGA
GCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACTGTCATACTGCTGGGTTTTCAT
GGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATAATGTCCTTCTTCATTGCTGAG
AGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCACTTTAGCATCACAGTGACCTT
TGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCCACCCCACCCCACCCTGTTCCT
TTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGTTAGACATGCACACAGACGCCA
TAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAATTTAGCTTTAAGGTTCTATAG
ATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTAATAAACCAGGATCCATTTAGG
TACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAATACGTTATTGCTTGATGAAGA
CCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGCAGTTTCTCAAAAGCAGAAACA
TGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGGAGGTCCGAACATTTTCTGAAT
TCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGTGTTGATTTACAAAGAGGCCAG
CTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTATGGCAAAGGTTCTTGAGAATC
AGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGATTGTTTAAGAACTATTTTAAA
GTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCAAGGTAGATTTTTGTTTTAAAA
TGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATGAAAACAGCAGGCTATTAGAAA
ATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCTTCTCTTTTCTGTACTCTAGAC
CACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCATGTGTTGCATTATTGCAGCAT
TAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTCAATGCCAGGCAGGTCTCCTAA
ATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCAACTGTGTCCCACAGGAATGGG
AGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCCGATTGTTAAAAAGTTGGCTCA
ATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAAACATGATCATTGTTCTCTCAC
GGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGTTACCACAAGCTAAGAAACTGA
GTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTGTGACCCTCAGCTGTCTCCCTT
TGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAGAGACATCCTAGCAAATCCTTC
CTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCCAGGTTTAGATAGGAAAGTACA
TGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCAATGGGGGCCTCCAGAGACCCT
CTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGACAAAAGTACAAACAGTCTGAGG
CTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGGTTTTCTCTCCCAGTCTCCCAG
CAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAAACAATCCCAGCCCCACCCAGC
AACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGGCTGAGGCTTGGAGCATCTCCT
CAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAAAACCAGTTTCACGCCAGGTGC
GAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCACTTGACTTTTTTTTCTCTCTC
TCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAGAATTAGAACACACACGACTTT
TTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTTACACCTCCGCCTGTTTTGGTG
CTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCATCTTGTTTTGTCTAGACTCCAG
ATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCATCCAGCCACATGGGCAGGGCCA
GTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAATTAGTACAGAAGTAACCACTCT
ATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACATAGGGGAAGATTAAGGACTCT
TTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCAGCCCAGGAAAGTTCCATGACA
ATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAAAGAACGTCCCAGCCACCTGAT
TTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAGTGAGCACCCAGAATGTGTTGA
ACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAGCAAAAAGAAAGGAACAGAGAT
TTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAGATTCCTAAGAAACGCAAATCC
TTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATGCCCTGTTTTTTTTTTTTTTTT
CCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAAAATTTTTATTTTTAGTGCTGT

>In-frame_AFAP1_ENST00000360265_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2639nt
CTCCCAGTTGAATTTTGCTGCCTTAAAGCAGAAGCAAAGGAGTAGTGCATTTGTTAAGAAGAAGACGCCTGAATCTTTTAGTGGACCTGC
TTTCAGCAAACTTGTTTTTTAGGTCAGAATACTATATCCAATGATCAAGCTAAACATGAAATGCTTCGAGTAAGACTCAGTATTCATACT
TTGACATTTGCAAATCACTGGGTCTAATAATACTCTTCCTCTTTTGTTGTCAGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCT
TGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCAGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAA
AGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTGCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCA
GCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTCCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCC
CGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGCAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGG
GAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGACCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCG
GAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACCAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCC
TCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGACAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCA
GGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAGTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAG
TGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAGGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAG
CTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAGGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGC
CAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGTCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTC
CTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAACAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAA
CAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCTATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGA
TTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCAGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTG
GATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTGCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGT
CATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCTGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGC
CCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGCTCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGG
GGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCC
AAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGAAGTAATGAAATCCCTTCCAC
AGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAAT
GCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAA
ATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCC
CGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGT
GATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGT
AGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGAC
TTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAGTGCACACTGAATAGTCTAAT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_5429nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTC
TCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTC
CATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATT
GAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAA
AGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTG
AAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTC
AAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCA
CACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCC
GCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAA
ATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCT
CCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAA
CAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAG
GTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCC
AAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAG
GATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCG
AGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTG
TTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGC
TTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACT
AACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACA
GATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAA
AAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGA
GGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCAC
CTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTG
CAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGC
ACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTC
AGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCACTT
CCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTGTGC
AGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATGGAG
TTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATCCAC
GTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTTCAG
TGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTTGTT
TCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGTGCT
TCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAAAGA
AAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATTGAA
AGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGCCTG
TTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGGAAA
TCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAGAGTT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_5381nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCA
GCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGC
CCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGAC
ACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGC
TATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGT
GAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTT
GAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAA
CTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTG
GCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTAC
AGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGG
AGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACT
CAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGG
AAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCC
CAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTT
CACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCT
TTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTC
CCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTA
ATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGG
AAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTA
CTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAA
AACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGG
AAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGT
GCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGT
GTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAG
TTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTC
GGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAA
GCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCC
ATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGT
TTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAA
AGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGT
TTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATG
CCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATA
GAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAA
TTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTT
CTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAAT
TCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_7320nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTT
GTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCC
ATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGA
GGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTC
AAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTG
AAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAA
GTTGAGAACAGGTATAAGTGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGA
ATTCAGAGGGTTTGACTTTTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTAT
TAAAAGGTTATTTCCTTCACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTC
CTTAGCCAGCAAAACAAAACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACA
GCTGTTTTGTTGGGGCTATAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAAC
CTTGCCCTTTTTTATTTGCCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATT
ACAGAACTGCAGCTTTTCTACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGT
CCCCCCTACAACATACTGTCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAA
TGAATATATGCTTTATAATGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATG
GACACCTGTTTCATTCACTTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGT
TTGGCTATCCCCACCCCACCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACA
CAATCAGCTCTGACAGTTAGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAG
TTGCACAAATGCTGCAATTTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAA
CCAAGGCATTAATCTTAATAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCT
TTACATTAGCCACTAAATACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCC
ATGCCTTAAAGAGGGGCAGTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGC
TGGCCCCCAATGTGGGGAGGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTC
CGATCTTTCCCAAAGGTGTTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGC
CAGGCAGGAGCTCAGTATGGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGC
CATAGAAAGGCTATGGATTGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAA
CAGCTAGAAGGATTGCAAGGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACA
TCTCCTAGGGAATGATGAAAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGA
TGATCAGTAACATAGCTTCTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTT
TAGAGCTTCCTAATGCATGTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAAT
AAAGGTTCTGGCACTTCAATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACT
GTCCCCAGCCGCAGCCAACTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGAT
TTCGTGTGAAATGTCCCGATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTT
ATTACTTTTGTCTTAAAACATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATT
GCCATTGAGGGCTTTGTTACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTG
TGATTCCCACCATGCTGTGACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCC
TACTCCCGTGTGGCCAGAGACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGG
CCCAGTCAGGTGCTGCCAGGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTA
TATTTACTCATGGCTCAATGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGAC
ACTGACTCTGTGACGACAAAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGA
GATAATTGATTCAGGGGTTTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTA
GCAAGGACAAGAACTAAACAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTG
AATTAGGCCCAGAATGGCTGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCG
AAGAGCTGAAGACAGAAAACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTC
TTTATTTCTTTAGAGCACTTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTT
CATTGGTTGTTTCACAGAATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTT
CTTCCTTTGCATGATTTACACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACA
CTAGAAGTTTATTTCATCTTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTC
TCTCAGGGTTGGTGCATCCAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGA
CTTGACTCCAAGGAAATTAGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCC
AGGTTCATCTAAAGACATAGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTT
GGCTGACAGAACTCCCAGCCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTT
TGGTCTTCAGAGACAAAAGAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGC
TTTGGCATGTTCATGAGTGAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGG
AAAAAAAGTGTGAAAAGCAAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACAC
ATACAAAGTAACAAGAGATTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCC
TGTGAATCATTCTCATGCCCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAA
TGGATAATCATTTTAAAAATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_8502nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTC
TCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTC
CATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATT
GAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATAATTT
GGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTGCAAA
TTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGTGCTC
TAATGACTAACCCCTCAAAGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGAGCTC
AGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCACATCACCTGACAGCACGGGGTGGTTT
CCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAATGGA
AACACACCTTCTGAGCTGAAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTTGAAG
GGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGTAAAT
TAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATGCCCT
CTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCCAATG
AAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTGTGTT
TGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCTGAGG
AAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCACAGC
CCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAACATT
ACTTTGAGTACACATGAGCAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAGTTAC
CAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAACAATT
GCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATAATGG
CTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCATTAGG
ACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCATGGC
ACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGATATC
ATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGGAAAT
GAATACATGCTGCATAATTACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTTCAAG
CACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTTATCAAAAGAGAAATATCACCCAAGT
ATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTTAGGT
CAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATCAGAC
ATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTATTTCC
CAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTCTTGC
ATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACCCAGG
TGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACGGCAG
CTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCACCGT
AGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTTGTAG
TGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCACGGC
CAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAACTGGA
AGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTGTCAG
TGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTCAATC
CCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGTATTT
TAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCCACCA
GTTAGAGTTAACCACTGATATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGACCAT
ATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTGTAGG
AAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAGCTGG
CCACGTCAGACTCTCATATGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCTCTTG
TTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGATGATC
ACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACATCTCA
TACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTTTGGT
CACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTGATGT
CTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAATAATATGTTAGTGTTGATATTTTGC
ACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTCAGAA
CCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTTTATTCATTACTGTATATGGGTAGAG
ATCAATATTCTTTCTTATGCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACCCAAG
CTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATAAAGC
CCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAAAATA
AGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGATCCATTTATGTTTTCATGCTCAATA
CTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCACTAAC
TGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCTCTAT
CTTGGTTTTACTTCCATAAACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAGGAAC
TATGATGCTAATGATCACATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTACAGAAACAATTATCAATACATGTAG
CTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAGGAGT
CTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTCTACCTAGATTTTTATGGACATTGGA
TTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGGGAGG
GAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTCCTTCTCGGATTGTGTATATGCTCTG
CCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGTTCTT
GGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGAGGAA
GAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTCCCCATGCCATCTATTTACTTTTGGA
GAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACTGTGA
TTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATTCAGC
CTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTCTCCC
ACATTTCATGCAAGGGAGCGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGTATGA
GTGACCAATGGAGCTTGGAATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTGGAATTTGTGATGTAGTTGATCATTC

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_8454nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCA
GCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGC
CCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGAC
ACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAGGAGGCTAAAT
CCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTTCCATAACCTA
GCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCAAAGTACTATGCCACTTTAACTATAGACCCAT
CTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTAGCTCGTTTAG
ACGTGTCTGAACACCACATCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGTGTTGCTTTCC
TTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCTGAAACAAACAAACAGAAACAAAACATACTAA
CCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAACACTATAGATG
TCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAAAATTGTCTCT
AAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAGGCATGTAAAG
TATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATACTTCTCCAGC
TATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTTACTAGGCAAT
TATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATTAGCTAAAGCT
ATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTGGAGGTGATAT
TTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGAGCAAAAATTCTGAATTACATCCAGGACCCCA
GAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACCATGGTCCATT
TTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTTTTGTCTTTCA
AAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATGGCCTGCACTT
TAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGCTTCTTTTATG
GCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTTCCCCCTCTCA
GTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGCTATCAAATAA
TGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAATTACATTTAAAATGTAAGCCATGTTATTATA
AGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCTGACCATTGGG
TAATATTATTCTTTGTTATCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTCCTAAGCTTGG
TGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACTCCCTCATCAT
CGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCTAGAAGCATCC
CAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGATGAATCCAAT
CAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAAACACAGTTGC
AGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGAGATGGCACCA
CCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATGCAGCTTTTCT
CTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTCTCCTTCCTGG
GGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTGTTCTTCTTTC
TCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAACCTGGTTGCC
ACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCCCGAGGAGGAG
ATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTTTCATTTTTAA
AACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGATAGGATTGTCT
TCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACCTGGAAAACAT
AAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTGATATCGTTTGGATATATGGCTTTCTAGTCTT
GTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAATATTTCTATAG
TAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTGTATTTCCTTG
GAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCATATGGTAAGTATCACAGAGCACATGAGGCCTG
TGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCATCACTCCAGA
TAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCTTTCAAAGAGC
CGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATCAAGGATACCT
TGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGTCCAGTGATCC
CCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGAGGCCTCTATC
AATAGTATGACATCCAATAATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTTCAAATGAATA
AGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAATATAATCCTAG
TTTCTATATATTATTTTTATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTATGCTGTTACTATTAATTAACACATTTTTTAA
CCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCCATATTCCTAA
ATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCACTTTAGGGAA
TGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTTTTCCTACAGG
AATGATTACTTTTCAGATCCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTTTTGCAAGTCA
TTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCTATTAATAGAG
TACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCATAAACATCAATATCTTTACCCACATGATTTTT
CCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCACATTTCTTCCTAGTTCCTAATTTCATTAGTG
CCATTTCCTGATATCTACAGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTCCAAGTGCTGT
CAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACATGTGAGATTT
TTGATTTCACTGAATTCTACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATATTGGTGATACA
TAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCACTCATGTCCT
GAATCAATCACACTTTCCTTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAAGTGGATCTTA
GCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGAGGATTCATGT
CATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGCTGGGTTGGGG
GATTAGTTCATATGGTCCCCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTTCCTCAAGGAA
ACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCCTCCTACCAGG
GCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAGGGAAGGGGTT
CTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGAGCGGACCTAACACATGACTTGCATTCTCTTC
CTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTGGAATTCTTTATCTATATGATCTGTCCGAAAA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_4333nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTC
TCATGGTTTGGATTTGGGAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTC
CATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATT
GAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAA
AGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTG
AAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTC
AAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCA
CACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCC
GCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAA
ATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCT
CCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAA
CAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAG
GTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCC
AAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAG
GATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCG
AGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTG
TTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGC
TTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACT
AACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACA
GATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAA
AAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGA
GGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCAC
CTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTG
CAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGC
ACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTC

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_4114nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCA
GCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGC
CCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGAC
ACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGC
TATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGT
GAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTT
GAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAA
CTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTG
GCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTAC
AGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGG
AGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACT
CAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGG
AAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCC
CAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTT
CACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCT
TTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTC
CCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTA
ATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGG
AAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTA
CTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAA
AACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGG
AAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGT

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_7316nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTT
GTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCC
ATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGA
GGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTC
AAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTG
AAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAA
GTTGAGAACAGGTATAAGTGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGA
ATTCAGAGGGTTTGACTTTTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTAT
TAAAAGGTTATTTCCTTCACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTC
CTTAGCCAGCAAAACAAAACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACA
GCTGTTTTGTTGGGGCTATAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAAC
CTTGCCCTTTTTTATTTGCCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATT
ACAGAACTGCAGCTTTTCTACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGT
CCCCCCTACAACATACTGTCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAA
TGAATATATGCTTTATAATGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATG
GACACCTGTTTCATTCACTTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGT
TTGGCTATCCCCACCCCACCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACA
CAATCAGCTCTGACAGTTAGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAG
TTGCACAAATGCTGCAATTTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAA
CCAAGGCATTAATCTTAATAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCT
TTACATTAGCCACTAAATACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCC
ATGCCTTAAAGAGGGGCAGTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGC
TGGCCCCCAATGTGGGGAGGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTC
CGATCTTTCCCAAAGGTGTTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGC
CAGGCAGGAGCTCAGTATGGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGC
CATAGAAAGGCTATGGATTGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAA
CAGCTAGAAGGATTGCAAGGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACA
TCTCCTAGGGAATGATGAAAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGA
TGATCAGTAACATAGCTTCTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTT
TAGAGCTTCCTAATGCATGTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAAT
AAAGGTTCTGGCACTTCAATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACT
GTCCCCAGCCGCAGCCAACTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGAT
TTCGTGTGAAATGTCCCGATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTT
ATTACTTTTGTCTTAAAACATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATT
GCCATTGAGGGCTTTGTTACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTG
TGATTCCCACCATGCTGTGACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCC
TACTCCCGTGTGGCCAGAGACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGG
CCCAGTCAGGTGCTGCCAGGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTA
TATTTACTCATGGCTCAATGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGAC
ACTGACTCTGTGACGACAAAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGA
GATAATTGATTCAGGGGTTTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTA
GCAAGGACAAGAACTAAACAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTG
AATTAGGCCCAGAATGGCTGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCG
AAGAGCTGAAGACAGAAAACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTC
TTTATTTCTTTAGAGCACTTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTT
CATTGGTTGTTTCACAGAATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTT
CTTCCTTTGCATGATTTACACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACA
CTAGAAGTTTATTTCATCTTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTC
TCTCAGGGTTGGTGCATCCAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGA
CTTGACTCCAAGGAAATTAGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCC
AGGTTCATCTAAAGACATAGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTT
GGCTGACAGAACTCCCAGCCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTT
TGGTCTTCAGAGACAAAAGAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGC
TTTGGCATGTTCATGAGTGAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGG
AAAAAAAGTGTGAAAAGCAAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACAC
ATACAAAGTAACAAGAGATTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCC
TGTGAATCATTCTCATGCCCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAA
TGGATAATCATTTTAAAAATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTA

>In-frame_AFAP1_ENST00000358461_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2677nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGCTCAAGGGTAAAAAGCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCC
GCGGCTGTTGTGAAAAGGACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATC
GGGGACACCACGAACAGAAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTG
GTGATTGCGTCTGTGGTGGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTT
GTTTTGTTTCATAAGATCCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCC
ATGTAAGCTGGACTCCTGGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGA
GGCTGTACTATATGAAGCCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTC
AAGAAAACATGTTAAATTAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTG
AAAAGTGTGCTTTTTGACCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAA

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_5681nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGG
AAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGG
AGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTT
GGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGA
GCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCC
AGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGC
GTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTG
CTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTG
GCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATG
TCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTAC
AGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTG
TCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTG
GGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTAC
CTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACT
GCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACT
TCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTA
AATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAAC
TCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTAT
TCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTAT
GGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAA
TCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACT
GGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTT
CTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATG
GCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAG
CGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAA
CTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTT
CCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGA
CGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCA
ATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTG
TGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCC
CTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAA
AAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGG
TTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTC
AAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTC
ATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCT
TATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGT
CAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAGAGTTGGGTCGTTTGTTCTCTTT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_5633nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAAT
GATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATT
GGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATC
AAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAG
CAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACC
AACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGG
GACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATG
CTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTG
GTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACA
ATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTG
TGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAG
CGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATC
CATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAA
CGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAAC
ATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTT
CTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTA
CCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGA
CACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTT
AAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTG
GATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGA
TTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTT
AGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTT
CCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTT
GTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTC
ATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTA
CAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTC
TTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTA
TACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCC
TGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAG
GGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTC
CATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCC
CAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTG
AATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACAT
CTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTC
TGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGT
GCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATAT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_7572nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATC
CCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTG
GGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGC
CTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATT
AATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGAC
CCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAG
TGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACTT
TTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTTC
ACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAAA
ACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCTA
TAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTTG
CCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTTC
TACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACTG
TCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATAA
TGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCAC
TTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCCA
CCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGTT
AGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAAT
TTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTAA
TAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAAT
ACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGCA
GTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGGA
GGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGTG
TTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTAT
GGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGAT
TGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCAA
GGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATGA
AAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCTT
CTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCAT
GTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTCA
ATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCAA
CTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCCG
ATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAAA
CATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGTT
ACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTGT
GACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAGA
GACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCCA
GGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCAA
TGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGACA
AAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGGT
TTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAAA
CAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGGC
TGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAAA
ACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCAC
TTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAGA
ATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTTA
CACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCATC
TTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCATC
CAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAATT
AGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACAT
AGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCAG
CCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAAA
GAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAGT
GAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAGC
AAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAGA
TTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATGC
CCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAAA
ATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTAACAAGCCAATAAAGTTTG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_8754nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGG
AAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGG
AGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTT
GGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCTG
TGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACATC
TTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCAA
AGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGGA
GTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCACATCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAAA
CTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCTG
AAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTAT
CTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGGT
TGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGCT
AGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAAT
TTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGTT
TTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAAG
GGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCTT
ACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGAG
CAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGAC
TTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTCT
GTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTTT
GTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTATT
TTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTGC
AGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACTC
CAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAAT
TACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGTA
AAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTTATCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCTC
CTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGATA
TTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCAC
CAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACTG
GAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGTG
GACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAGT
GCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGAA
GGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCAG
ATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTTT
TGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGAG
AGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCCT
CTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGCA
GTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCCA
ATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATAA
TGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTGA
TATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTGT
TTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTATT
ATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCATA
TGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCTG
AGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGTT
CTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTTA
GGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTTA
AACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCTA
GACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAATAATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTTA
AGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAAT
CCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTTTATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTAT
GCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATAA
TGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTAT
ATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCACT
AAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGATCCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTGC
AACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCAG
AACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCATA
AACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCAC
ATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTACAGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTTA
GAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGATG
GCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTCTACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACAC
TCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTAG
CAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTCCTTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTAC
ATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGTG
TCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGGC
GGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTCCCCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGTG
GGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCCC
CATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCAT
GTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGAG
CGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTGG
AATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTGGAATTTGTGATGTAGTTGATCATTCAGAGCCAAACGCATATAC

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_8706nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAAT
GATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATT
GGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCC
CCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGAG
AAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGCC
TTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCAAAGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGGA
TGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCACA
TCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAGA
AACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCTGAAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAAT
CATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTGT
CTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATGT
GTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTTT
TTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGTG
TGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAGA
TTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCAT
TCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAGA
GGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGAGCAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAAA
GAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAGG
ACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCTA
ATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTCC
ATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGAC
TCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCAT
TGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAACT
TGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAATTACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAAG
ATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTTA
TCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAACA
AAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGAG
TTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCCT
AATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATTT
TGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGTT
GCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGAT
GTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCTG
CCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCTC
TGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGAA
GAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTCT
CCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCCT
TTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAAA
CAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCCT
TCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAAC
GAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTGATATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAATC
TCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGGG
AGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTAA
GAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCATATGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAGA
CTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTTT
ATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTTA
AAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCTC
TGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATGA
AAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAAT
AATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAGA
GATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTTT
ATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTATGCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTTT
GGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGTT
GATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATTA
CATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGAT
CCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTACT
ACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGAC
TAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCATAAACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTTT
CCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCACATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTAC
AGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTAG
TCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTCT
ACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATTT
CCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTCC
TTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAAT
GGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTGC
CTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTCC
CCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGGG
CACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTCA
TTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATGT
TGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGAGCGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCCA
GGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTGGAATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTGG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_4585nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGGG
AAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGG
AGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTT
GGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGA
GCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCC
AGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGC
GTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTG
CTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTG
GCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATG
TCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTAC
AGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTG
TCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTG
GGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTAC
CTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACT
GCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACT
TCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTA
AATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAAC
TCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTAT
TCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTAT
GGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAA
TCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACT
GGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTT
CTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATG
GCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_4366nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAAT
GATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATT
GGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATC
AAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAG
CAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACC
AACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGG
GACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATG
CTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTG
GTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACA
ATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTG
TGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAG
CGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATC
CATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAA
CGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAAC
ATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTT
CTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTA
CCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGA
CACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTT
AAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTG
GATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGA
TTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTT
AGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTT

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_7568nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATC
CCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTG
GGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGC
CTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATT
AATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGAC
CCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAG
TGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACTT
TTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTTC
ACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAAA
ACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCTA
TAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTTG
CCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTTC
TACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACTG
TCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATAA
TGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCAC
TTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCCA
CCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGTT
AGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAAT
TTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTAA
TAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAAT
ACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGCA
GTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGGA
GGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGTG
TTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTAT
GGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGAT
TGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCAA
GGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATGA
AAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCTT
CTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCAT
GTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTCA
ATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCAA
CTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCCG
ATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAAA
CATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGTT
ACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTGT
GACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAGA
GACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCCA
GGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCAA
TGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGACA
AAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGGT
TTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAAA
CAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGGC
TGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAAA
ACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCAC
TTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAGA
ATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTTA
CACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCATC
TTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCATC
CAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAATT
AGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACAT
AGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCAG
CCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAAA
GAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAGT
GAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAGC
AAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAGA
TTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATGC
CCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAAA
ATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTAACAAGCCAATAAAGTTTG

>In-frame_AFAP1_ENST00000420658_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2929nt
GGGCGCCCGGCTCCGCTGGGGGCGGGACGGCGGGCGGCGGGCGGGGCCGTGTGCGCCTGCGTGGTGTCTGTCCCGGCCGCAGCCCCACGC
CGGCTGCAGCTCCGCGAGCCGAGCCGGATCTCGAGCGGGGTACACGGGCTGAGGCGGCGGCGGCGGCCCCGCCCCGGGGCTCCATTGTTA
AGGCGGCTGCGGCTCTGTCGGCTGTTCAGCTGCGCTCCAGTCGGCCCAGGCGCCGCGGCGAGGAGCGAGCGCTGCGAGGTGGCGGCCTGA
GCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGCA
GTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCTG
CCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCTC
CCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAGC
AGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGAC
CTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACACC
AAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGAC
AGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCAG
TGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAAG
GCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAAG
GAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAGT
CTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAAC
AGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTCT
ATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGCA
GTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCTG
CACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATCT
GCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGGC
TCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAAC
TTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTAC
AAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAAG
CCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAGG
ACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAGA
AGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGTG
GGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGATC
CCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCTG
GGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAGC
CTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAATT
AATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGAC
CCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAAG

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376214_chr9_87356807_+_5412nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGG
GAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGG
GAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTT
TGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGG
AGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGC
CAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTG
CGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGT
GCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCT
GGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGAT
GTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTA
CAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCT
GTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCT
GGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTA
CCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAAC
TGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTAC
TTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTT
AAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAA
CTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTA
TTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTA
TGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCA
ATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCAC
TGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTT
TCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGAT
GGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAA
GCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGA
ACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACT
TCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAG
ACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATC
AATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACT
GTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTC
CCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAA
AAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTG
GTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCT
CAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATT
CATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACC
TTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAG
TCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAGAGTTGGGTCGTTTGTTCTCTT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376213_chr9_87356807_+_5364nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAA
TGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTAT
TGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACAT
CAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGA
GCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGAC
CAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGG
GGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGAT
GCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCT
GGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACAC
AATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTT
GTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCA
GCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCAT
CCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCA
ACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAA
CATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTT
TCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTT
ACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAG
ACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACT
TAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTT
GGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAG
ATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGT
TAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTT
TCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTT
TGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATT
CATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTT
ACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGT
CTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTT
ATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACC
CTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGA
GGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACT
CCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGC
CCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTT
GAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACA
TCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCT
CTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAG
TGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395882_chr9_87356807_+_7303nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGAT
CCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCT
GGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAG
CCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAAT
TAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGA
CCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAA
GTGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACT
TTTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTT
CACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAA
AACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCT
ATAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTT
GCCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTT
CTACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACT
GTCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATA
ATGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCA
CTTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCC
ACCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGT
TAGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAA
TTTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTA
ATAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAA
TACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGC
AGTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGG
AGGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGT
GTTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTA
TGGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGA
TTGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCA
AGGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATG
AAAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCT
TCTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCA
TGTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTC
AATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCA
ACTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCC
GATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAA
ACATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGT
TACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTG
TGACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAG
AGACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCC
AGGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCA
ATGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGAC
AAAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGG
TTTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAA
ACAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGG
CTGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAA
AACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCA
CTTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAG
AATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTT
ACACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCAT
CTTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCAT
CCAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAAT
TAGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACA
TAGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCA
GCCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAA
AGAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAG
TGAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAG
CAAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAG
ATTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATG
CCCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAA
AATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTAACAAGCCAATAAAGTTT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000304053_chr9_87356807_+_8485nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGG
GAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGG
GAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTT
TGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTCCCCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCT
GTGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGAGAAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACAT
CTTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGCCTTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCA
AAGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGGATGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGG
AGTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCACATCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAA
ACTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAGAAACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCT
GAAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAATCATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTA
TCTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTGTCTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGG
TTGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATGTGTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGC
TAGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTTTTTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAA
TTTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGTGTGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGT
TTTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAGATTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAA
GGGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCATTCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCT
TACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAGAGGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGA
GCAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAAAGAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGA
CTTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAGGACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTC
TGTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCTAATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTT
TGTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTCCATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTAT
TTTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGACTCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTG
CAGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCATTGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACT
CCAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAACTTGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAA
TTACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAAGATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGT
AAAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTTATCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCT
CCTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAACAAAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGAT
ATTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGAGTTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCA
CCAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCCTAATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACT
GGAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATTTTGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGT
GGACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGTTGCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAG
TGCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGATGTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGA
AGGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCTGCCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCA
GATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCTCTGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTT
TTGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGAAGAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGA
GAGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTCTCCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCC
TCTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCCTTTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGC
AGTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAAACAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCC
AATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCCTTCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATA
ATGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAACGAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTG
ATATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAATCTCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTG
TTTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGGGAGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTAT
TATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTAAGAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCAT
ATGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAGACTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCT
GAGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTTTATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGT
TCTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTTAAAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTT
AGGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCTCTGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTT
AAACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATGAAAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCT
AGACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAATAATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTT
AAGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAGAGATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAA
TCCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTTTATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTA
TGCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTTTGGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATA
ATGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGTTGATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTA
TATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATTACATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCAC
TAAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGATCCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTG
CAACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTACTACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCA
GAACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGACTAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCAT
AAACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTTTCCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCA
CATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTACAGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTT
AGAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTAGTCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGAT
GGCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTCTACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACA
CTCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATTTCCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTA
GCAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTCCTTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTA
CATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAATGGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGT
GTCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTGCCTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGG
CGGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTCCCCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGT
GGGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGGGCACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCC
CCATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTCATTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCA
TGTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATGTTGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGA
GCGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCCAGGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTG
GAATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTGGAATTTGTGATGTAGTTGATCATTCAGAGCCAAACGCATATA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000376208_chr9_87356807_+_8437nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAA
TGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTAT
TGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATGGCCCAGAGGTTC
CCCCAAGACCGCCTGATAATAATTTGGTATTTGGAGGCTCCTGTGTCACTGCAGGAACTAAAGGAGGCTAAATCCATGCCTGATGGAGGA
GAAGAGTTCTATGGTTATCTGCAAATTCTGGCCAGACAACATCTTGACGTCACTCCTTAGCTTCCATAACCTAGCCAAGCAAGAAGTTGC
CTTTCCAAGACAAAGCAGTGTGCTCTAATGACTAACCCCTCAAAGTACTATGCCACTTTAACTATAGACCCATCTCCTCGATCAATCAGG
ATGGCAAGATGGAGCTGAGGAGCTCAGCAACATCAAGTCTGGAGTTGGTCTTTAACTCAACTAGCTCGTTTAGACGTGTCTGAACACCAC
ATCACCTGACAGCACGGGGTGGTTTCCCAGTAAAATTTACAAACTCAGCTCAAGGGCAGCTGTGTTGCTTTCCTTTCCTTGACTGCTGAG
AAACTTTTTGACAGGGAACAATGGAAACACACCTTCTGAGCTGAAACAAACAAACAGAAACAAAACATACTAACCAGCAAAATCCCCAAA
TCATCAATCTTGGGTTCTCTTGAAGGGCAGGAGTGTGTTTTATCTTCTCCCGTCGGAGCAAACACTATAGATGTCCTCCCTAAAATTCTG
TCTTCCCTAGAGCAGCCTTGTAAATTAGCTAGGGTCCTAGGGTTGAGGCCTAAATCAACTTAAAATTGTCTCTAAATATGTACCTGGATG
TGTTTGTACTTGCAGAGCATGCCCTCTTCATGTGCCTAGGGCTAGTAACTCCCTGTGGCAGAGGCATGTAAAGTATTCTGACTTTTTTTT
TTTCAACTTAATTCCATTTCCAATGAAATGGATTTTTAAAAATTTTCTCCAGAGTGTGCCATACTTCTCCAGCTATTATAGTTAATGTGT
GTGTATCCTTGTGTATATGTGTGTTTGTGTGTGCATATGTGTTTTCCTAGTGGTTACATGCTTACTAGGCAATTATGTAAATAAGCACAG
ATTCATAGGCCAGCTAGGCCTGAGGAAAGAAGACATTATAAAGGGAGGGAGTATTTTAACATTAGCTAAAGCTATCACACAAGGCACCCA
TTCTGCTCCCCTCAACAGCCACAGCCCACTTCGTCCTTGTCTTACCAATAAGGGGAAAGGCTGGAGGTGATATTTTTCACAGAACCGCAG
AGGTTTTGAACATATTTGCAACATTACTTTGAGTACACATGAGCAAAAATTCTGAATTACATCCAGGACCCCAGAAGCTCATTAGATCAA
AGAGTGCGGGGCCCCTCAGAGTTACCAGAGATTATCTGCAGACTTCAGTGCAATCGAATGACCATGGTCCATTTTGATGGTCAGAGGTAG
GACTGAAAAACGGGTAGAAACAATTGCTTTAGCGCTTCCTTCTGTACTTTGCCTATTAATGTTTTGTCTTTCAAAAATATATTTTCTCCT
AATTGTTTAATTGGCCAAATAATGGCTGCTTTGGGAGTTGTTTGTATGCCTTGGAAGGCCATGGCCTGCACTTTAAAAATAAGCTAAGTC
CATTCTGCCCAGCACGAGCATTAGGACAGAGAATGCACTTATTTTAGGATCCTTAAAAATTGCTTCTTTTATGGCACACTGGGTTGACGA
CTCATCTCGTGGGAGCCTTCATGGCACATTGCTGCTGTTCTGCAGGTCCCAATACAATTCCTTCCCCCTCTCAGTGCCACGGCCCCCCCA
TTGCTAGCTACAACAATTTGATATCATATTCCCTTTTCAACTCCAAAGGAGATGATAAGAAGCTATCAAATAATGCTTTAAAAAAGCAAC
TTGAGTTTCTTAAAAGAAAGGAAATGAATACATGCTGCATAATTACATTTAAAATGTAAGCCATGTTATTATAAGCCGCACTGAGATGAA
GATTTGTTAGCAAACCAGTTTCAAGCACACTCACAGTGAAGTAAAATCATGTTTTTAGCATCTGACCATTGGGTAATATTATTCTTTGTT
ATCAAAAGAGAAATATCACCCAAGTATAGTATACTTAGACCTCCTAGAGGAAACACTCCAGTCCTAAGCTTGGTGTCTGAAAAGAAAAAC
AAAAATAAAGATTATGGATTTAGGTCAGGGAGACAGAGTGATATTCTGAAGACTGTGTTTACTCCCTCATCATCGGCCAACCAAGATGGA
GTTCTGCATCCTGCACATATCAGACATTTCAGTCCAATTTCACCAAAGCATCAGTGATGTTCTAGAAGCATCCCAGCAGATGGAGGATCC
TAATGTATTTGTTCTGGGTATTTCCCAAGGCCCAGCCTGACTGGAGTGTGTGTACCAACAGGATGAATCCAATCAAGCTACGCCCCCATT
TTGGTTTCGGATTGGCCACTCTTGCATGTGCTAGTAGATTGTGGACCAGGACCAGCTGAGCAAACACAGTTGCAGAGTAGCCTCCTATGT
TGCTAAGAAGCTCCTGCTACCCAGGTGCTTTGAACAATTGAGTGCTCCCTCTGGTTAAGTAGAGATGGCACCACCGGAGTTTTTCTTGGA
TGTGAGGCTCAATCCTTTACGGCAGCTATTATAACAAAGTGAAGGTTTTCTCCCTGGGAAATGCAGCTTTTCTCTGTCTTTACTAATTCT
GCCAGCCTGTGAGAGTAACCACCGTAGCTGGGCTTCTTCTCAGATTAATTGTCATGCCAGGTCTCCTTCCTGGGGAGCTGTGATGCTGCT
CTGAGGTTGATTGCTGAGGTTGTAGTGGGTTTTTGTTTGTTTTTGTTTAGTTTTTCTTGATTGTTCTTCTTTCTCTTGAATGGCAAGAGA
AGAAACACTTTCTCTAACCCACGGCCAGGAAGGAAATGGGGAGAGAGCTACTTCTTAGTTCAACCTGGTTGCCACATAAAGGAATCTCTC
TCCTTGGACTCAGCCCCTAACTGGAAGCAAGAGCCACTGCCCTCTGAGACTGAGAGAGCAGCCCGAGGAGGAGATGAATCCATTCTGCCC
TTTGTTTGGGTTTGCTTCCTGTCAGTGAGAGAATGCTGAGGCAGTTCCTGTTATGTGAAACTTTCATTTTTAAAACCAGGACAGTCCTAA
ACAGACTGGAATGAGTTGGTCAATCCCAGTTGGTATAGGCCCAATGATTTTTGCTAGTAAGATAGGATTGTCTTCCTCACCCAAAATGCC
TTCAAGTGCCCTAAAATGGGTATTTTAAAATAAGAATAAATAATGTAGATTTAGTAGAAAACCTGGAAAACATAAGAAACAAAGATGAAA
CGAAAAGTCCCATGTAATTCCACCAGTTAGAGTTAACCACTGATATCGTTTGGATATATGGCTTTCTAGTCTTGTGGATATCCTTTTAAT
CTCTTGTAATATAAAGTCTGACCATATGTGTCCTTGCATTTGTTTGTACTGGACTCTGTTAATATTTCTATAGTAATGGCTCACTTTGGG
GAGATTGTGCTGCACAGTGTGTAGGAAGCACATTGGGTGTATTATTCCCAGTTTTGTATTTTGTATTTCCTTGGAGATGTGCAGGGGTTA
AGAGCGGGGGTCTGGCCATAGCTGGCCACGTCAGACTCTCATATGGTAAGTATCACAGAGCACATGAGGCCTGTGTTATGCGCTGGAAAG
ACTCAGGAAATGAGAGGCTCTCTTGTTCTGACAAGGCAGGCTGAGAGCTCTCATTTAGGGTCATCACTCCAGATAACTCCAAATGCAGTT
TATTGCTCAACTGAAGCAGATGATCACTTTTTGCCTCCAAGTTCTTCACCCTAGCTAGCTCCTTTCAAAGAGCCGAGTATGCTGGATCTT
AAAGGGCCAAACTAGTTACATCTCATACATTTCCTGATGTTTAGGGATGCCTTCACTTCCATCAAGGATACCTTGGCTGTGCAAGGACCT
CTGATAGCTGGAGTCTCCTTTTGGTCACTCCCAGCTTTGCTTAAACTTGATGGAGTTTGCTGTCCAGTGATCCCCGGATCTTTCATCATG
AAAGCCTTCCTTCCTCTCCTGATGTCTCAGGCCTCTAGACCTAGACTGGGGTTCTGGCAAGGAGGCCTCTATCAATAGTATGACATCCAA
TAATATGTTAGTGTTGATATTTTGCACAGTAATATTAAGTTTAAGAGATTATAAAAATGAGTTCAAATGAATAAGTTCCTGTGATGTAAG
AGATTAGATATGTGTGATTTCAGAACCAAAGGCAGGGGGGAATCCCAGAAAGAAAACAATAATATAATCCTAGTTTCTATATATTATTTT
TATTCATTACTGTATATGGGTAGAGATCAATATTCTTTCTTATGCTGTTACTATTAATTAACACATTTTTTAACCATGCCATTGAACTTT
TGGGTGCATTAAAGTGGAACCCAAGCTCCTCATTAGATAATAATGGCATTTGGACTGAGTGCCATATTCCTAAATTTCCAATAAAGTGGT
TGATATAGAGAGGACAGGATAAAGCCCTATAGTGTGCAGTTATATCAAAACAGCTAGTCTCCACTTTAGGGAATGCCTTTACTAGAGATT
ACATGAAATGTCTGCTTATAAAATAAGCAGAGATGGCACCACTAAGCAGCCACCTGAATTGTTTTCCTACAGGAATGATTACTTTTCAGA
TCCATTTATGTTTTCATGCTCAATACTTACTCCCCTTCCCTGCAACACCCAAAGAGTTTACTTTTGCAAGTCATTTGGTCTTCAGTCTAC
TACTGAGGAATAGAGAGGCACTAACTGCTTTACCCAGGATCAGAACTCATGTTCTTACCTTCTATTAATAGAGTACTTGAGCCAGATGGA
CTAACTGGTCTCACATTTTCTCTATCTTGGTTTTACTTCCATAAACATCAATATCTTTACCCACATGATTTTTCCATCCTCCCATTTTTT
TCCATATGTATTAGGGTTCAGGAACTATGATGCTAATGATCACATTTCTTCCTAGTTCCTAATTTCATTAGTGCCATTTCCTGATATCTA
CAGAAACAATTATCAATACATGTAGCTGCTTGAGCCTTATTTAGAAGGCTAGCCTTTCTTTTCCAAGTGCTGTCAGAATGTATACATTTA
GTCTGTCTTTTTCCCTTTTAGGAGTCTTTGTTCTGGGTTGATGGCAAAATTCCTCTTTTTACATGTGAGATTTTTGATTTCACTGAATTC
TACCTAGATTTTTATGGACATTGGATTTTAAAGAGGAAAACACTCATTTTCTTAGTAAGATATTGGTGATACATAGCTATGCCATTGATT
TCCATACTCCTGAGCTTTGGGGAGGGAGACAGTGGCCAAGTAGCAGGCAGAATAAGATCATCACTCATGTCCTGAATCAATCACACTTTC
CTTCTCGGATTGTGTATATGCTCTGCCACTTCCTACATATTACATCCTGAGTTTTTAAGTAAAGTGGATCTTAGCCAGATTTGAGTCTAA
TGGCTGATTCATCGGCATAGTTCTTGGCGTTAACATCTCAGTGTCCTCTTTAGTTCTCTTTGAGGATTCATGTCATTGAGGGCCTTTGTG
CCTCCACTTGTCTCAGTATGAGGAAGAACTTTGGTGTGAGGGCGGAGCTATGTGAAGGGTTGCTGGGTTGGGGGATTAGTTCATATGGTC
CCCATGCCATCTATTTACTTTTGGAGAGAGGGGACTTTGAGTGGGTGGGTATGGATAGATGTTCCTCAAGGAAACCCTGCTGGCTAATGG
GCACTACATCTGTGTATTACTGTGATTCTCTCTGTAAGCTCCCCATGTGGCCAAGGACCCCCCTCCTACCAGGGCACTTCCTGCCACCTC
ATTGCACTGGTCTCAACCATTCAGCCTGCTGCTGCTGCACCATGTTGGGCTGCGGTAGGATAGGGAAGGGGTTCTGTTGATTGCTAAATG
TTGCCTAACTTTATTTCCCTCTCCCACATTTCATGCAAGGGAGCGGACCTAACACATGACTTGCATTCTCTTCCTATGTTCAGAAACTCC
AGGGCTTGCCCACGTGTATGTATGAGTGACCAATGGAGCTTGGAATTCTTTATCTATATGATCTGTCCGAAAATGAGATCTTTTGTACTG

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000277120_chr9_87356807_+_4316nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGATTTCTCATGGTTTGGATTTGG
GAAAGTAAAATCAAGACAAGGTGTTGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGG
GAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTT
TGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGG
AGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGC
CAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTG
CGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGT
GCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCT
GGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGAT
GTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTA
CAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCT
GTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCT
GGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTA
CCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAAC
TGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTAC
TTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTT
AAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAA
CTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTA
TTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTA
TGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCA
ATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCAC
TGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTT
TCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGAT
GGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAA

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000323115_chr9_87356807_+_4097nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGCCCAGCCTCCGTTATCAGCAA
TGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTAT
TGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACAT
CAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGA
GCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGAC
CAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGG
GGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGAT
GCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCT
GGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACAC
AATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTT
GTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCA
GCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCAT
CCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCA
ACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAA
CATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTT
TCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTT
ACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAG
ACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACT
TAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTT
GGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAG
ATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGT
TAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000359847_chr9_87356807_+_7299nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGAT
CCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCT
GGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAG
CCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAAT
TAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGA
CCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAA
GTGCACACTGAATAGTCTAATCTACATGTAACACATATTTTAGTGTGATTTTCTATACTCTAATCAGCACTGAATTCAGAGGGTTTGACT
TTTTCATCTATAACACAGTGACTAAAAGAGTTAAGGGTATATATACCATCACTTTGGGACTTGGTAGTATTATTAAAAGGTTATTTCCTT
CACTGTCAATAAAAGTCCAAATGTTTAGCTTAGGTCTGAGAGTCAAACAATGTTAAGGATTGTCTTAAAGTTCCTTAGCCAGCAAAACAA
AACAAAACAAAACAAACAAATGAAAAACGTTTAAAAAGAAGAAGAAGAAAAAAAACAAGAACAAGCAGCAACAGCTGTTTTGTTGGGGCT
ATAGATTTAAGTTAGGCATAGTCAATTTCAGAATAACTAAGAGTGGAATATATGCATATGGTGAAATTATAACCTTGCCCTTTTTTATTT
GCCCTCTGCGATCCACCTGCTTTTTAGAAGTCTGCCGAGTGAGAAGGCCACAGTATCTCATGCTGTTTGCATTACAGAACTGCAGCTTTT
CTACTCTGAAAAGGCCTGGGAGCAGAATGGCTGGCCTGCTGTGAGCAGGAGAGGAGATTCTAAGAAGGATAGTCCCCCCTACAACATACT
GTCATACTGCTGGGTTTTCATGGGTAGGAAAGCTTGTCCTGACCCCAGCAGCAAAGAGGTGGCAGGTCGCTAATGAATATATGCTTTATA
ATGTCCTTCTTCATTGCTGAGAGGGCAGCCTTAGAGCTGTGGATTTCTGCATCCCCCCTGAGTCTGACCCATGGACACCTGTTTCATTCA
CTTTAGCATCACAGTGACCTTTGTATGCTCTGTTCAGTCTGTGTCAGGCAGTATGCTTGTCCTGAAGAGAGGTTTGGCTATCCCCACCCC
ACCCCACCCCACCCTGTTCCTTTTTTATCAGGAGGACTTCAGAGCCAGGCCTGCAGCATTTTGTTTGAAAACACAATCAGCTCTGACAGT
TAGACATGCACACAGACGCCATAGCTGGATTGGAAACATTGATGTTTTAAAAATTTATTTTTTTTGGAAATAGTTGCACAAATGCTGCAA
TTTAGCTTTAAGGTTCTATAGATTTTTAACTAGTCCAACACAGTCAGAAACATTGTTTTGAATCCTCTGTAAACCAAGGCATTAATCTTA
ATAAACCAGGATCCATTTAGGTACCACTTGATATAAAAAGGATATCCATAATGAATATTTTATACTGCATCCTTTACATTAGCCACTAAA
TACGTTATTGCTTGATGAAGACCTTTCACAGAATCCTATGGATTGCAGCATTTCACTTGGCTACTTCATACCCATGCCTTAAAGAGGGGC
AGTTTCTCAAAAGCAGAAACATGCCGCCAGTTCTCAAGTTTTCCTCCTAACTCCATTTGAATGTAAGGGCAGCTGGCCCCCAATGTGGGG
AGGTCCGAACATTTTCTGAATTCCCATTTTCTTGTTCGCGGCTAAATGACAGTTTCTGTCATTACTTAGATTCCGATCTTTCCCAAAGGT
GTTGATTTACAAAGAGGCCAGCTAATAGCAGAAATCATGACCCTGAAAGAGAGATGAAATTCAAGCTGTGAGCCAGGCAGGAGCTCAGTA
TGGCAAAGGTTCTTGAGAATCAGCCATTTGGTACAAAAAAGATTTTTAAAGCTTTTATGTTATACCATGGAGCCATAGAAAGGCTATGGA
TTGTTTAAGAACTATTTTAAAGTGTTCCAGACCCAAAAAGGAAAAATAAAAAAAAAGGAATATTTGTACCCAACAGCTAGAAGGATTGCA
AGGTAGATTTTTGTTTTAAAATGGAGAGAAGTGGACAGATAAGGCCATTTAATATATCAAAGATCAGTTGACATCTCCTAGGGAATGATG
AAAACAGCAGGCTATTAGAAAATTATTTCATATAGTTCTCGTGTTCTTTTCTTTTTTTTAATCCCTGAAGGGATGATCAGTAACATAGCT
TCTCTTTTCTGTACTCTAGACCACCCCTTTTCATCATTTTGCTTTTTATGTCTCCCATAAGAAATGTGCTTTTTAGAGCTTCCTAATGCA
TGTGTTGCATTATTGCAGCATTAGAAAAGGAGAGGTAGCATTTTTGCTGAAATCGGGCCTGTCACTCTCCAATAAAGGTTCTGGCACTTC
AATGCCAGGCAGGTCTCCTAAATGAACAGAATGATCTGTGTGAGCCGATGCCTGCCCTTCCAGAGGGGCCACTGTCCCCAGCCGCAGCCA
ACTGTGTCCCACAGGAATGGGAGCCTAGGTTTCCAAATCTTGTGATTCTTTAGGAGAAACATGAAACCTGGATTTCGTGTGAAATGTCCC
GATTGTTAAAAAGTTGGCTCAATTATTTTTAAAACATTTTGTAAGCCAACAAAAGTCTGTGGGCTGCCAGTTTATTACTTTTGTCTTAAA
ACATGATCATTGTTCTCTCACGGTATCCTTCTGTCTTCCCGTTGCAAATTCACTTTTCTTTCTTCCTGACATTGCCATTGAGGGCTTTGT
TACCACAAGCTAAGAAACTGAGTTTAACAGCCCAGTTATCTGCAACATGTCAATTACCTTTGCTCCTCTCCTGTGATTCCCACCATGCTG
TGACCCTCAGCTGTCTCCCTTTGCTGGGAATTCTGCACCAATGTCTCCCCTCAACCCATTCCCTGGTTGGTCCTACTCCCGTGTGGCCAG
AGACATCCTAGCAAATCCTTCCTCCTATTATATCTGACACTAATTTCTTTTCAACAGCGCTCATGTCTCTTGGCCCAGTCAGGTGCTGCC
AGGTTTAGATAGGAAAGTACATGTCCCATTTTCATGGGTGCCCTTAATGTGGTCCACGTCCTATATCTTATTATATTTACTCATGGCTCA
ATGGGGGCCTCCAGAGACCCTCTCAGGCTGCTGAGCTAGACTAAGGAATGCATCCACCGTCATCACATGAGACACTGACTCTGTGACGAC
AAAAGTACAAACAGTCTGAGGCTAAGAAAGGTTCATCTCACAACAGGAAAAACAAATCTCAACACACATTAGAGATAATTGATTCAGGGG
TTTTCTCTCCCAGTCTCCCAGCAGGGACTGATTTCATTTCTGACCCACTAGGTTTTCTTTCCAGAAATAGGTAGCAAGGACAAGAACTAA
ACAATCCCAGCCCCACCCAGCAACACAGAACACAGGAGTTTGCTTTTGGCTTCTCACTCTCCAAGTAACCCTGAATTAGGCCCAGAATGG
CTGAGGCTTGGAGCATCTCCTCAGACAGAGCAGAGGCGACACCTCTTCAGGGGTGTGTGGAGTAAATAGCTCGAAGAGCTGAAGACAGAA
AACCAGTTTCACGCCAGGTGCGAGAGAGAGCATAATGGAGGGAAGCCCGCTTTCTCTCTCCTCTTCTTTTCTCTTTATTTCTTTAGAGCA
CTTGACTTTTTTTTCTCTCTCTCTCTAGTATTCTAAACTGACCCCATGACCAACTGAGAATTTATTTTTGTTTCATTGGTTGTTTCACAG
AATTAGAACACACACGACTTTTTATTCCTCCATTGCAAAATGGAATCAAGATACTACACAAGACCTGTGCTTTCTTCCTTTGCATGATTT
ACACCTCCGCCTGTTTTGGTGCTAGCTGTCTAGAACTTCTCTCTTGGTTTGAATCTGATTCCTTCACACTACACTAGAAGTTTATTTCAT
CTTGTTTTGTCTAGACTCCAGATACAGAGGGACAGCTGGACTGAGGACAAGCAATTCCATCTAGCATAGGGTCTCTCAGGGTTGGTGCAT
CCAGCCACATGGGCAGGGCCAGTCACATCTAGTCTATGTCCCCAGAGCCCTTGGAGTTGCGCAGCTTAGCTGACTTGACTCCAAGGAAAT
TAGTACAGAAGTAACCACTCTATTAAGTGTGTTCTGCTATGTTCACATGCCTGTAGTACCTGCAAACCATGCCAGGTTCATCTAAAGACA
TAGGGGAAGATTAAGGACTCTTTTGGACAGACCATGAATTGAATTTGCTGCCAGGTGCTGCCAGACTGAATTTGGCTGACAGAACTCCCA
GCCCAGGAAAGTTCCATGACAATGACTGTCGCAGAAGGAAATTTCCCACTAAAGTCAGTCCATTTTCAAGTTTTGGTCTTCAGAGACAAA
AGAACGTCCCAGCCACCTGATTTTGATGGTGAGGTAACTCTAAGTTGAATTCAGGCTAGTGTTGCAGTATAGCTTTGGCATGTTCATGAG
TGAGCACCCAGAATGTGTTGAACCAACCCCCACCCCTAACTACTGACTATGACTGCAGTGGGTTTTTATGGGGAAAAAAAGTGTGAAAAG
CAAAAAGAAAGGAACAGAGATTTTTTATCACCTTTATTGTAAGACAGTCCATTTATGAATTGAGTATAAACACATACAAAGTAACAAGAG
ATTCCTAAGAAACGCAAATCCTTGAGTTTCACGCACTTCATGTTCAACCATTTGCTGTAATCCAGAGGCAGCCTGTGAATCATTCTCATG
CCCTGTTTTTTTTTTTTTTTTCCTATAATGTTCTGGGTTTAAAAGCCATCTTTTCCACATTTTCTGTAAATAATGGATAATCATTTTAAA
AATTTTTATTTTTAGTGCTGTTTTAACAATGTAGATAGATCATAAATGTACTTGCTGAATTCAATCATTTTTAACAAGCCAATAAAGTTT

>In-frame_AFAP1_ENST00000382543_chr4_7780489_-_NTRK2_ENST00000395866_chr9_87356807_+_2660nt
AGCAATGGAAGAGTTAATAGTTGAACTTCGTCTCTTTCTTGAACTCCTGGACCATGAATATCTAACCTCAACTGTCAGGGAGAAAAAGGC
AGTGATAACCAACATTCTGCTAAGAATACAGTCATCCAAAGGTTTTGATGTGAAGGACCATGCTCAGAAGCAGGAGACCGCTAACAGCCT
GCCAGCCCCTCCTCAGATGCCCCTGCCGGAGATCCCTCAGCCCTGGCTGCCTCCTGACAGTGGGCCTCCACCATTGCCAACATCCTCCCT
CCCAGAAGGTTATTATGAGGAAGCTGTGCCGCTGAGCCCCGGAAAAGCTCCGGAATACATCACATCAAATTATGATTCCGATGCGATGAG
CAGCTCTTATGAGTCGTATGATGAAGAGGAGGAGGATGGGAAGGGGAAGAAAACCCGGCACCAGTGGCCCTCCGAGGAGGCCTCCATGGA
CCTGGTCAAGGACGCCAAAATCTGCGCCTTCCTGCTGCGGAAGAAGCGGTTCGGCCAGTGGACCAAGTTGCTCTGCGTCATCAAAGACAC
CAAACTGCTGTGCTATAAAAGTTCCAAGGACCAGCAGCCTCAGATGGAACTGCCACTCCAAGGCTGTAACATTACGTACATCCCGAAAGA
CAGCAAAAAGAAGAAGCACGAGCTGAAGATTACTCAGCAGGGCACGGACCCGCTTGTTCTCGCCGTCCAGAGCAAGGAACAGGCCGAGCA
GTGGCTGAAGGTGATCAAAGAAGCCTACAGTGGTTGTAGTGGCCCCGTGGATTCAGAGTGTCCTCCTCCACCAAGCTCCCCGGTGCACAA
GGCAGAACTGGAGAAGAAACTGTCTTCAGAGAGACCCAGCTCAGATGGGGAGGGTGTTGTGGAAAATGGAATTACCACATGTAATGGAAA
GGAGCAAGTGAAGAGGAAGAAAAGTTCCAAATCAGAGGCCAAGGGCACTGTGTCGAAAGTCACTGGGAAAAAAATCACCAAGATCATCAG
TCTGGGAAAGAAAAAGCCGTCCACAGACGAGCAGACCTCCTCAGCTGAGGAAGATGTTCCCACCTGCGGCTATCTGAACGTGCTCTCCAA
CAGCCGCTGGCGAGAGCGCTGGTGCCGAGTGAAAGATAACAAGCTCATTTTCCACAAGGACAGGACCGACCTGAAGACCCATATTGTGTC
TATTCCGCTCCGTGGCTGCGAGGTGATCCCGGGTTTGGATTCTAAACATCCTCTGACGTTCCGGCTGCTGCGCAACGGCCAGGAGGTTGC
AGTATTGGAGGCATCTTCTTCTGAAGACATGGGCAGGTGGATTGGGATTTTACTCGCAGAGACGGGATCGTCCACAGACCCGGAGGCTCT
GCACTATGACTACATTGATGTGGAGATGTCTGCAAGTGTCATTCAGACAGCCAAACAGACCTTCTGTTTCATGAACAGGCGTGTTATATC
TGCTAACCCATATCTAGGGGGCACCTCCAACGGCTATGCCCACCCCAGCGGGACGGCACTTCATTATGACGATGTCCCGTGCATCAACGG
CTCGTGGGAACCGGAAGACGGCTTTCCTGCTTCCTGCAGCAGAGGCTTGGGAGAAGAGGTGCTTTATGATAACGCAGGCCTGTACGATAA
CTTGCCGCCTCCGCACATCTTTGCCCGCTACTCTCCTGCTGACAGAAAGGCCTCTAGGCTGTCTGCTGACAAGCTGTCCTCTAACCATTA
CAAATACCCTGCCTCCGCTCAGTCTGTCACTAATACCTCTTCTGTGGGGAGGGCGTCTCTCGGGCTCAACTCGCAGCTCAAGGGTAAAAA
GCCCCCCGTGGCGTCTAATGGGGTCACAGGAAAAGGGAAGACTCTGAGCAGTCAGCCAAAGAAAGCGGATCCCGCGGCTGTTGTGAAAAG
GACGGGTTCGAGTGCAAACCCAAATTATCCTGATGTAATTTATGAAGATTATGGAACTGCAGCGAATGACATCGGGGACACCACGAACAG
AAGTAATGAAATCCCTTCCACAGACGTCACTGATAAAACCGGTCGGGAACATCTCTCGGTCTATGCTGTGGTGGTGATTGCGTCTGTGGT
GGGATTTTGCCTTTTGGTAATGCTGTTTCTGCTTAAGTTGGCAAGACACTCCAAGTTTGGCATGAAAGGTTTTGTTTTGTTTCATAAGAT
CCCACTGGATGGGTAGCTGAAATAAAGGAAAAGACAGAGAAAGGGGCTGTGGTGCTTGTTGGTTGATGCTGCCATGTAAGCTGGACTCCT
GGGACTGCTGTTGGCTTATCCCGGGAAGTGCTGCTTATCTGGGGTTTTCTGGTAGATGTGGGCGGTGTTTGGAGGCTGTACTATATGAAG
CCTGCATATACTGTGAGCTGTGATTGGGGAACACCAATGCAGAGGTAACTCTCAGGCAGCTAAGCAGCACCTCAAGAAAACATGTTAAAT
TAATGCTTCTCTTCTTACAGTAGTTCAAATACAAAACTGAAATGAAATCCCATTGGATTGTACTTCTCTTCTGAAAAGTGTGCTTTTTGA
CCCTACTGGACATTTATTGACTTAATTGCTTCTGTTTATTAAAATTGACCTGCAAAGTTAAAAAAAAATTAAAGTTGAGAACAGGTATAA


Top

FusionGenePPI for AFAP1_NTRK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFAP1AFAP1, ACTC1, PRKCB, PRKCE, PRKCG, PRKCD, PRKCA, MYC, NXF1, BRCA1, CAPZA2, CDK2, DBN1, FLNA, GAK, MYH9, MYO1C, PPP1CB, IQGAP1, SYNPO, MAPRE1, TPX2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, EXT2, TRIM25, TESNTRK2NTF3, FYN, FRS2, SHC1, PLCG1, BDNF, NTF4, SHC3, GIPC1, SQSTM1, PIK3R1, SH2B1, NCK2, PTPN1, TRAF6, HSP90AA1, POLR2G, AP1B1, NMNAT1, RANBP9, TNK2, EGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneAFAP1chr4:7780489chr9:87356807ENST00000358461-1317594_637548731F-actin
HgeneAFAP1chr4:7780489chr9:87356807ENST00000360265-1216594_637548731F-actin
HgeneAFAP1chr4:7780489chr9:87356807ENST00000382543-1317594_637632815F-actin
HgeneAFAP1chr4:7780489chr9:87356807ENST00000420658-1418594_637632815F-actin


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFAP1_NTRK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneNTRK2Q16620DB00321AmitriptylineBDNF/NT-3 growth factors receptorsmall moleculeapproved

Top

RelatedDiseases for AFAP1_NTRK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNTRK2C0011570Mental Depression5PSYGENET
TgeneNTRK2C0011581Depressive disorder5PSYGENET
TgeneNTRK2C0041696Unipolar Depression5PSYGENET
TgeneNTRK2C0525045Mood Disorders5PSYGENET
TgeneNTRK2C1269683Major Depressive Disorder5PSYGENET
TgeneNTRK2C0005586Bipolar Disorder3CTD_human;PSYGENET
TgeneNTRK2C0036341Schizophrenia2PSYGENET
TgeneNTRK2C0038220Status Epilepticus2CTD_human
TgeneNTRK2C0236736Cocaine-Related Disorders2CTD_human
TgeneNTRK2C0424295Hyperactive behavior2CTD_human
TgeneNTRK2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneNTRK2C0004114Astrocytoma1CTD_human
TgeneNTRK2C0004352Autistic Disorder1CTD_human
TgeneNTRK2C0008073Developmental Disabilities1CTD_human
TgeneNTRK2C0013415Dysthymic Disorder1PSYGENET
TgeneNTRK2C0017638Glioma1CTD_human
TgeneNTRK2C0020505Hyperphagia1CTD_human;HPO
TgeneNTRK2C0027819Neuroblastoma1CTD_human
TgeneNTRK2C0028754Obesity1CTD_human;HPO
TgeneNTRK2C0036349Paranoid Schizophrenia1PSYGENET
TgeneNTRK2C0678807prenatal alcohol exposure1PSYGENET
TgeneNTRK2C0752347Lewy Body Disease1CTD_human
TgeneNTRK2C3146244Alcohol Related Birth Defect1PSYGENET
TgeneNTRK2C3151303Obesity, Hyperphagia, and Developmental Delay1UNIPROT