FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9888

FusionGeneSummary for DHRS1_METTL3

check button Fusion gene summary
Fusion gene informationFusion gene name: DHRS1_METTL3
Fusion gene ID: 9888
HgeneTgene
Gene symbol

DHRS1

METTL3

Gene ID

115817

56339

Gene namedehydrogenase/reductase 1methyltransferase like 3
SynonymsSDR19C1IME4|M6A|MT-A70|Spo8|hMETTL3
Cytomap

14q12

14q11.2

Type of geneprotein-codingprotein-coding
Descriptiondehydrogenase/reductase SDR family member 1dehydrogenase/reductase (SDR family) member 1short chain dehydrogenase/reductase family 19C member 1N6-adenosine-methyltransferase catalytic subunitN6-adenosine-methyltransferase 70 kDa subunitadoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferasemRNA (2'-O-methyladenosine-N(6)-)-methyltransferasemRNA m(6)A methyltransferasemethy
Modification date2018051920180523
UniProtAcc

Q96LJ7

Q86U44

Ensembl transtripts involved in fusion geneENST00000559088, ENST00000288111, 
ENST00000396813, 
ENST00000298717, 
ENST00000538267, ENST00000545319, 
Fusion gene scores* DoF score1 X 1 X 1=12 X 2 X 2=8
# samples 12
** MAII scorelog2(1/1*10)=3.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: DHRS1 [Title/Abstract] AND METTL3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMETTL3

GO:0006974

cellular response to DNA damage stimulus

28297716

TgeneMETTL3

GO:0031053

primary miRNA processing

25799998

TgeneMETTL3

GO:0034644

cellular response to UV

28297716

TgeneMETTL3

GO:0080009

mRNA methylation

24316715|27281194|27373337|27627798|28297716

TgeneMETTL3

GO:1990744

primary miRNA methylation

25799998


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-39-5019-01ADHRS1chr14

24768163

-METTL3chr14

21970045

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000559088ENST00000298717DHRS1chr14

24768163

-METTL3chr14

21970045

-
intron-3UTRENST00000559088ENST00000538267DHRS1chr14

24768163

-METTL3chr14

21970045

-
intron-intronENST00000559088ENST00000545319DHRS1chr14

24768163

-METTL3chr14

21970045

-
In-frameENST00000288111ENST00000298717DHRS1chr14

24768163

-METTL3chr14

21970045

-
5CDS-3UTRENST00000288111ENST00000538267DHRS1chr14

24768163

-METTL3chr14

21970045

-
5CDS-intronENST00000288111ENST00000545319DHRS1chr14

24768163

-METTL3chr14

21970045

-
Frame-shiftENST00000396813ENST00000298717DHRS1chr14

24768163

-METTL3chr14

21970045

-
5CDS-3UTRENST00000396813ENST00000538267DHRS1chr14

24768163

-METTL3chr14

21970045

-
5CDS-intronENST00000396813ENST00000545319DHRS1chr14

24768163

-METTL3chr14

21970045

-

Top

FusionProtFeatures for DHRS1_METTL3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DHRS1

Q96LJ7

METTL3

Q86U44

The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues atthe N(6) position of some RNAs and regulates various processessuch as the circadian clock, differentiation of embryonic andhaematopoietic stem cells, cortical neurogenesis, response to DNAdamage, differentiation of T-cells and primary miRNA processing(PubMed:22575960, PubMed:24284625, PubMed:25719671,PubMed:25799998, PubMed:26321680, PubMed:26593424,PubMed:27627798, PubMed:27373337, PubMed:27281194,PubMed:28297716, PubMed:29506078, PubMed:29348140,PubMed:9409616). In the heterodimer formed with METTL14, METTL3constitutes the catalytic core (PubMed:27627798, PubMed:27373337,PubMed:27281194). N6-methyladenosine (m6A), which takes place atthe 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role inmRNA stability, processing, translation efficiency and editing(PubMed:22575960, PubMed:24284625, PubMed:25719671,PubMed:25799998, PubMed:26321680, PubMed:26593424,PubMed:28297716, PubMed:9409616). M6A acts as a key regulator ofmRNA stability: methylation is completed upon the release of mRNAinto the nucleoplasm and promotes mRNA destabilization anddegradation (PubMed:28637692). In embryonic stem cells (ESCs), m6Amethylation of mRNAs encoding key naive pluripotency-promotingtranscripts results in transcript destabilization, promotingdifferentiation of ESCs (By similarity). M6A regulates the lengthof the circadian clock: acts as an early pace-setter in thecircadian loop by putting mRNA production on a fast-track forfacilitating nuclear processing, thereby providing an early pointof control in setting the dynamics of the feedback loop (Bysimilarity). M6A regulates spermatogonial differentiation andmeiosis and is essential for male fertility and spermatogenesis(By similarity). Involved in the response to DNA damage: inresponse to ultraviolet irradiation, METTL3 rapidly catalyzes theformation of m6A on poly(A) transcripts at DNA damage sites,leading to the recruitment of POLK to DNA damage sites(PubMed:28297716). M6A is also required for T-cell homeostasis anddifferentiation: m6A methylation of transcripts of SOCS familymembers (SOCS1, SOCS3 and CISH) in naive T-cells promotes mRNAdestabilization and degradation, promoting T-cell differentiation(By similarity). M6A also takes place in other RNA molecules, suchas primary miRNA (pri-miRNAs) (PubMed:25799998). Mediates m6Amethylation of Xist RNA, thereby participating in random Xinactivation: m6A methylation of Xist leads to target YTHDC1reader on Xist and promote transcription repression activity ofXist (PubMed:27602518). M6A also regulates cortical neurogenesis:m6A methylation of transcripts related to transcription factors,neural stem cells, the cell cycle and neuronal differentiationduring brain development promotes their destabilization and decay,promoting differentiation of radial glial cells (By similarity).METTL3 mediates methylation of pri-miRNAs, marking them forrecognition and processing by DGCR8 (PubMed:25799998). Acts as apositive regulator of mRNA translation independently of themethyltransferase activity: promotes translation by interactingwith the translation initiation machinery in the cytoplasm(PubMed:27117702). Its overexpression in a number of cancer cellssuggests that it may participate to cancer cell proliferation bypromoting mRNA translation (PubMed:27117702).{ECO:0000250|UniProtKB:Q8C3P7, ECO:0000269|PubMed:22575960,ECO:0000269|PubMed:24284625, ECO:0000269|PubMed:25719671,ECO:0000269|PubMed:25799998, ECO:0000269|PubMed:26321680,ECO:0000269|PubMed:26593424, ECO:0000269|PubMed:27117702,ECO:0000269|PubMed:27281194, ECO:0000269|PubMed:27373337,ECO:0000269|PubMed:27602518, ECO:0000269|PubMed:27627798,ECO:0000269|PubMed:28297716, ECO:0000269|PubMed:28637692,ECO:0000269|PubMed:29348140, ECO:0000269|PubMed:29506078,ECO:0000269|PubMed:9409616}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for DHRS1_METTL3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DHRS1_ENST00000288111_chr14_24768163_-_METTL3_ENST00000298717_chr14_21970045_-_390aa
MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTK
EECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPP
QWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTN
QLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DHRS1_ENST00000288111_chr14_24768163_-_METTL3_ENST00000298717_chr14_21970045_-_1170nt
ATGGCAGCTCCCATGAATGGCCAAGTGTGTGTGGTGACTGGTGCCTCCAGGGGTATTGGCCGTGGCATTGCCTTGCAGCTCTGCAAAGCA
GGCGCCACAGTTTACATCACTGGCCGCCATCTGGACACCCTTCGCGTTGTTGCTCAGGAGGTCAGTCAGGAGATCCTAGAGCTATTAAAT
ACTACAACAGCCAAGGAACAATCCATTGTTGAAAAATTTCGCTCTCGAGGTCGGGCCCAAGTGCAAGAATTCTGTGACTATGGAACCAAG
GAGGAGTGCATGAAAGCCAGTGATGCTGATCGACCCTGTCGCAAGCTGCACTTCAGACGAATTATCAATAAACACACTGATGAGTCTTTA
GGTGACTGCTCTTTCCTTAATACATGTTTCCACATGGATACCTGCAAGTATGTTCACTATGAAATTGATGCTTGCATGGATTCTGAGGCC
CCTGGCAGCAAAGACCACACGCCAAGCCAGGAGCTTGCTCTTACACAGAGTGTCGGAGGTGATTCCAGTGCAGACCGACTCTTCCCACCT
CAGTGGATCTGTTGTGATATCCGCTACCTGGACGTCAGTATCTTGGGCAAGTTTGCAGTTGTGATGGCTGACCCACCCTGGGATATTCAC
ATGGAACTGCCCTATGGGACCCTGACAGATGATGAGATGCGCAGGCTCAACATACCCGTACTACAGGATGATGGCTTTCTCTTCCTCTGG
GTCACAGGCAGGGCCATGGAGTTGGGGAGAGAATGTCTAAATCTCTGGGGGTATGAACGGGTAGATGAAATTATTTGGGTGAAGACAAAT
CAACTGCAACGCATCATTCGGACAGGCCGTACAGGTCACTGGTTGAACCATGGGAAGGAACACTGCTTGGTTGGTGTCAAAGGAAATCCC
CAAGGCTTCAACCAGGGTCTGGATTGTGATGTGATCGTAGCTGAGGTTCGTTCCACCAGTCATAAACCAGATGAAATCTATGGCATGATT
GAAAGACTATCTCCTGGCACTCGCAAGATTGAGTTATTTGGACGACCACACAATGTGCAACCCAACTGGATCACCCTTGGAAACCAACTG
GATGGGATCCACCTACTAGACCCAGATGTGGTTGCACGGTTCAAGCAAAGGTACCCAGATGGTATCATCTCTAAACCTAAGAATTTATAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DHRS1_ENST00000288111_chr14_24768163_-_METTL3_ENST00000298717_chr14_21970045_-_1567nt
TACTACGTCATAGTTCCGCGCCGCCCCAGCCGGGCGGGGTGGGTGTGTCACCCAGATCGCTCCGCCCCCATCCGCAGGTTCTAACTTTGG
CCTGGGACTCTGCCCCTCTACCTCAGCACAGAATCGCCCCGGGTCCTACTACAGAATCAATCCTTGAACACTGCCTCCACGTCGCCGGCT
CAATCTGGGCGAGAACCCAGACTTCCACCGCAGCCCCGCAATCTGCAGACCTCAGCGGCAGCGCAGGTGGCAGACCTGCCTCCTTTGCCT
GTGAGTCATGGCAGCTCCCATGAATGGCCAAGTGTGTGTGGTGACTGGTGCCTCCAGGGGTATTGGCCGTGGCATTGCCTTGCAGCTCTG
CAAAGCAGGCGCCACAGTTTACATCACTGGCCGCCATCTGGACACCCTTCGCGTTGTTGCTCAGGAGGTCAGTCAGGAGATCCTAGAGCT
ATTAAATACTACAACAGCCAAGGAACAATCCATTGTTGAAAAATTTCGCTCTCGAGGTCGGGCCCAAGTGCAAGAATTCTGTGACTATGG
AACCAAGGAGGAGTGCATGAAAGCCAGTGATGCTGATCGACCCTGTCGCAAGCTGCACTTCAGACGAATTATCAATAAACACACTGATGA
GTCTTTAGGTGACTGCTCTTTCCTTAATACATGTTTCCACATGGATACCTGCAAGTATGTTCACTATGAAATTGATGCTTGCATGGATTC
TGAGGCCCCTGGCAGCAAAGACCACACGCCAAGCCAGGAGCTTGCTCTTACACAGAGTGTCGGAGGTGATTCCAGTGCAGACCGACTCTT
CCCACCTCAGTGGATCTGTTGTGATATCCGCTACCTGGACGTCAGTATCTTGGGCAAGTTTGCAGTTGTGATGGCTGACCCACCCTGGGA
TATTCACATGGAACTGCCCTATGGGACCCTGACAGATGATGAGATGCGCAGGCTCAACATACCCGTACTACAGGATGATGGCTTTCTCTT
CCTCTGGGTCACAGGCAGGGCCATGGAGTTGGGGAGAGAATGTCTAAATCTCTGGGGGTATGAACGGGTAGATGAAATTATTTGGGTGAA
GACAAATCAACTGCAACGCATCATTCGGACAGGCCGTACAGGTCACTGGTTGAACCATGGGAAGGAACACTGCTTGGTTGGTGTCAAAGG
AAATCCCCAAGGCTTCAACCAGGGTCTGGATTGTGATGTGATCGTAGCTGAGGTTCGTTCCACCAGTCATAAACCAGATGAAATCTATGG
CATGATTGAAAGACTATCTCCTGGCACTCGCAAGATTGAGTTATTTGGACGACCACACAATGTGCAACCCAACTGGATCACCCTTGGAAA
CCAACTGGATGGGATCCACCTACTAGACCCAGATGTGGTTGCACGGTTCAAGCAAAGGTACCCAGATGGTATCATCTCTAAACCTAAGAA
TTTATAGAAGCACTTCCTTACAGAGCTAAGAATCCATAGCCATGGCTCTGTAAGCTAAACCTGAAGAGTGATATTTGTACAATAGCTTTC


Top

FusionGenePPI for DHRS1_METTL3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DHRS1MDFI, PLSCR1, CDK2, KRTAP5-9, KRTAP3-2, KRTAP10-8, KRTAP10-3, NOTCH2NLMETTL3METTL14, MOV10, HIST1H2BG, CEP19, ROBO2, SEL1L, WTAP, RBM15B, PPHLN1, MPP1, MYC, ACTR2, SNW1, NSUN2, ARNTL2, SIRT6, LGALS7, OLFM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DHRS1_METTL3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DHRS1_METTL3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource