FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9209

FusionGeneSummary for CYTH3_MAD1L1

check button Fusion gene summary
Fusion gene informationFusion gene name: CYTH3_MAD1L1
Fusion gene ID: 9209
HgeneTgene
Gene symbol

CYTH3

MAD1L1

Gene ID

9265

8379

Gene namecytohesin 3mitotic arrest deficient 1 like 1
SynonymsARNO3|GRP1|PSCD3|cytohesin-3MAD1|PIG9|TP53I9|TXBP181
Cytomap

7p22.1

7p22.3

Type of geneprotein-codingprotein-coding
Descriptioncytohesin-3ARF nucleotide-binding site opener 3PH, SEC7 and coiled-coil domain-containing protein 3general receptor of phosphoinositides 1pleckstrin homology, Sec7 and coiled-coil domains 3mitotic spindle assembly checkpoint protein MAD1MAD1 mitotic arrest deficient like 1MAD1-like protein 1mitotic arrest deficient 1-like protein 1mitotic checkpoint MAD1 protein homologmitotic-arrest deficient 1, yeast, homolog-like 1tax-binding prote
Modification date2018051920180523
UniProtAcc

O43739

Q9Y6D9

Ensembl transtripts involved in fusion geneENST00000350796, ENST00000396741, 
ENST00000488964, 
ENST00000402746, 
ENST00000399654, ENST00000406869, 
ENST00000265854, ENST00000486340, 
Fusion gene scores* DoF score7 X 3 X 6=12610 X 12 X 9=1080
# samples 718
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/1080*10)=-2.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CYTH3 [Title/Abstract] AND MAD1L1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMAD1L1

GO:0090235

regulation of metaphase plate congression

20133940


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A09Q-01ACYTH3chr7

6210833

-MAD1L1chr7

1938026

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000350796ENST00000402746CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000350796ENST00000399654CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000350796ENST00000406869CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000350796ENST00000265854CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5CDS-intronENST00000350796ENST00000486340CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000396741ENST00000402746CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000396741ENST00000399654CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000396741ENST00000406869CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
In-frameENST00000396741ENST00000265854CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5CDS-intronENST00000396741ENST00000486340CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5UTR-3CDSENST00000488964ENST00000402746CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5UTR-3CDSENST00000488964ENST00000399654CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5UTR-3CDSENST00000488964ENST00000406869CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5UTR-3CDSENST00000488964ENST00000265854CYTH3chr7

6210833

-MAD1L1chr7

1938026

-
5UTR-intronENST00000488964ENST00000486340CYTH3chr7

6210833

-MAD1L1chr7

1938026

-

Top

FusionProtFeatures for CYTH3_MAD1L1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CYTH3

O43739

MAD1L1

Q9Y6D9

Promotes guanine-nucleotide exchange on ARF1 and ARF6.Promotes the activation of ARF factors through replacement of GDPwith GTP. Play a role in the epithelial polarization (Bysimilarity). {ECO:0000250|UniProtKB:O08967,ECO:0000269|PubMed:23940353, ECO:0000269|PubMed:9707577}. Component of the spindle-assembly checkpoint thatprevents the onset of anaphase until all chromosomes are properlyaligned at the metaphase plate. May recruit MAD2L1 to unattachedkinetochores. Has a role in the correct positioning of the septum.Required for anchoring MAD2L1 to the nuclear periphery. Binds tothe TERT promoter and represses telomerase expression, possibly byinterfering with MYC binding. {ECO:0000269|PubMed:10049595,ECO:0000269|PubMed:12837246, ECO:0000269|PubMed:20133940}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCYTH3chr7:6210833chr7:1938026ENST00000350796-71314_61187400Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCYTH3chr7:6210833chr7:1938026ENST00000350796-713264_381187400DomainPH
HgeneCYTH3chr7:6210833chr7:1938026ENST00000350796-71377_206187400DomainSEC7
HgeneCYTH3chr7:6210833chr7:1938026ENST00000350796-713273_281187400RegionNote=Phosphatidylinositol 3%2C4%2C5-trisphosphate binding
HgeneCYTH3chr7:6210833chr7:1938026ENST00000350796-713392_400187400RegionC-terminal autoinhibitory region
TgeneMAD1L1chr7:6210833chr7:1938026ENST00000265854-151846_632602719Coiled coilOntology_term=ECO:0000255
TgeneMAD1L1chr7:6210833chr7:1938026ENST00000399654-161946_632602719Coiled coilOntology_term=ECO:0000255
TgeneMAD1L1chr7:6210833chr7:1938026ENST00000406869-161946_632602719Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for CYTH3_MAD1L1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_304aa
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKTEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIE
NDLLQSSPEDVAQFLTKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHT

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_304aa
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKTEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIE
NDLLQSSPEDVAQFLTKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHT

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_304aa
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKTEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIE
NDLLQSSPEDVAQFLTKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHT

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_304aa
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKTEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIE
NDLLQSSPEDVAQFLTKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHT

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_219aa
MALPQLQTAMLAAFLWDPRDVVLTAQPGAEQCAESSQHIRILQPQFRLIRLRFWKLYIQRRVQAWQFLWSFRLPGEAQKIDRMMEAFASR
YCLCNPGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLET

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_219aa
MALPQLQTAMLAAFLWDPRDVVLTAQPGAEQCAESSQHIRILQPQFRLIRLRFWKLYIQRRVQAWQFLWSFRLPGEAQKIDRMMEAFASR
YCLCNPGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLET

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_219aa
MALPQLQTAMLAAFLWDPRDVVLTAQPGAEQCAESSQHIRILQPQFRLIRLRFWKLYIQRRVQAWQFLWSFRLPGEAQKIDRMMEAFASR
YCLCNPGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLET

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_219aa
MALPQLQTAMLAAFLWDPRDVVLTAQPGAEQCAESSQHIRILQPQFRLIRLRFWKLYIQRRVQAWQFLWSFRLPGEAQKIDRMMEAFASR
YCLCNPGVFQSTELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLET


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_912nt
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGA
AAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAA
AATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGG
CAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAG
ATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTAC
GCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACC
GTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_912nt
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGA
AAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAA
AATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGG
CAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAG
ATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTAC
GCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACC
GTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_912nt
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGA
AAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAA
AATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGG
CAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAG
ATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTAC
GCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACC
GTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_912nt
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGA
AAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAA
AATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGG
CAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAG
ATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTAC
GCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACC
GTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAG

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_657nt
ATGGCCTTACCTCAACTGCAGACTGCAATGTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAA
CAGTGCGCTGAGAGTTCGCAACATATAAGAATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGA
AGGGTGCAGGCCTGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGC
TACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAG
GTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGG
CTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACA
GAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAG

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_657nt
ATGGCCTTACCTCAACTGCAGACTGCAATGTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAA
CAGTGCGCTGAGAGTTCGCAACATATAAGAATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGA
AGGGTGCAGGCCTGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGC
TACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAG
GTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGG
CTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACA
GAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAG

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_657nt
ATGGCCTTACCTCAACTGCAGACTGCAATGTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAA
CAGTGCGCTGAGAGTTCGCAACATATAAGAATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGA
AGGGTGCAGGCCTGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGC
TACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAG
GTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGG
CTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACA
GAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAG

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_657nt
ATGGCCTTACCTCAACTGCAGACTGCAATGTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAA
CAGTGCGCTGAGAGTTCGCAACATATAAGAATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGA
AGGGTGCAGGCCTGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGC
TACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAG
GTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGG
CTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACA
GAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_1325nt
GGAGGAGGCCCGGCCGCGACCCGGGCCGCGCGCTGAGGAGCCGCCCGGTCGCCTGCGCGCTCCCTCCGGCGGCGTCCCCAGCCCGCGGCC
CCTCTGCTGCCGGCCCCCGGCTCGCCGGCTGCGGGAGTGGCCTCAAGATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAG
ACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAA
TTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAGAGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAA
AGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCC
TTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTGGGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTG
TTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGA
TTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGA
GTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACC
AGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_1325nt
GGAGGAGGCCCGGCCGCGACCCGGGCCGCGCGCTGAGGAGCCGCCCGGTCGCCTGCGCGCTCCCTCCGGCGGCGTCCCCAGCCCGCGGCC
CCTCTGCTGCCGGCCCCCGGCTCGCCGGCTGCGGGAGTGGCCTCAAGATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAG
ACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAA
TTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAGAGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAA
AGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCC
TTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTGGGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTG
TTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGA
TTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGA
GTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACC
AGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_1325nt
GGAGGAGGCCCGGCCGCGACCCGGGCCGCGCGCTGAGGAGCCGCCCGGTCGCCTGCGCGCTCCCTCCGGCGGCGTCCCCAGCCCGCGGCC
CCTCTGCTGCCGGCCCCCGGCTCGCCGGCTGCGGGAGTGGCCTCAAGATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAG
ACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAA
TTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAGAGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAA
AGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCC
TTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTGGGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTG
TTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGA
TTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGA
GTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACC
AGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_CYTH3_ENST00000350796_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_1308nt
GGAGGAGGCCCGGCCGCGACCCGGGCCGCGCGCTGAGGAGCCGCCCGGTCGCCTGCGCGCTCCCTCCGGCGGCGTCCCCAGCCCGCGGCC
CCTCTGCTGCCGGCCCCCGGCTCGCCGGCTGCGGGAGTGGCCTCAAGATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAG
ACCTCTCATTAGAAGAGAGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGGCTGAAATATGAAA
TTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAGAGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAA
AGAAATTCAACATGGATCCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGACGTCGCCCAGTTCC
TTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTGGGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTG
TTGAACTCCATGAGTTTGCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGGGAGGCGCAGAAGA
TTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCAGTCCACAGAGCTGAAGAAGCAGGTGGAGA
GTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAGGCCTGCTACACGCTCACCGGCTACC
AGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGGCGACTGCCTCATCTTCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000402746_chr7_1938026_-_1084nt
AGCACTCAGCAGCATCCGGGGGAGAGGAGGCAGGGCTTCTGGTGGGAGTCGCCTCAGCCGGCCCTTGGACTAAGAAAATCAGGCCGCACC
TCGTCATCTTCTCAAATCTTCGGCTTCATACCTTGTTCTCGTTTACGTGGACTGTTTGCTCATGGCCTTACCTCAACTGCAGACTGCAAT
GTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAACAGTGCGCTGAGAGTTCGCAACATATAAG
AATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGAAGGGTGCAGGCCTGGCAGTTCTTATGGAG
CTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCA
GTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCG
CAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGG
CGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA
CGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCGGCCACCAGCCTGGGTTCCTCACCTTGTGAAATAAAATCTTCTCCCCT

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000399654_chr7_1938026_-_1084nt
AGCACTCAGCAGCATCCGGGGGAGAGGAGGCAGGGCTTCTGGTGGGAGTCGCCTCAGCCGGCCCTTGGACTAAGAAAATCAGGCCGCACC
TCGTCATCTTCTCAAATCTTCGGCTTCATACCTTGTTCTCGTTTACGTGGACTGTTTGCTCATGGCCTTACCTCAACTGCAGACTGCAAT
GTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAACAGTGCGCTGAGAGTTCGCAACATATAAG
AATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGAAGGGTGCAGGCCTGGCAGTTCTTATGGAG
CTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCA
GTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCG
CAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGG
CGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA
CGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCGGCCACCAGCCTGGGTTCCTCACCTTGTGAAATAAAATCTTCTCCCCT

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000406869_chr7_1938026_-_1084nt
AGCACTCAGCAGCATCCGGGGGAGAGGAGGCAGGGCTTCTGGTGGGAGTCGCCTCAGCCGGCCCTTGGACTAAGAAAATCAGGCCGCACC
TCGTCATCTTCTCAAATCTTCGGCTTCATACCTTGTTCTCGTTTACGTGGACTGTTTGCTCATGGCCTTACCTCAACTGCAGACTGCAAT
GTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAACAGTGCGCTGAGAGTTCGCAACATATAAG
AATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGAAGGGTGCAGGCCTGGCAGTTCTTATGGAG
CTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCA
GTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCG
CAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGG
CGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA
CGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCGGCCACCAGCCTGGGTTCCTCACCTTGTGAAATAAAATCTTCTCCCCT

>In-frame_CYTH3_ENST00000396741_chr7_6210833_-_MAD1L1_ENST00000265854_chr7_1938026_-_1067nt
AGCACTCAGCAGCATCCGGGGGAGAGGAGGCAGGGCTTCTGGTGGGAGTCGCCTCAGCCGGCCCTTGGACTAAGAAAATCAGGCCGCACC
TCGTCATCTTCTCAAATCTTCGGCTTCATACCTTGTTCTCGTTTACGTGGACTGTTTGCTCATGGCCTTACCTCAACTGCAGACTGCAAT
GTTGGCAGCGTTTTTGTGGGACCCTCGTGATGTTGTGCTCACAGCGCAGCCTGGGGCTGAACAGTGCGCTGAGAGTTCGCAACATATAAG
AATCCTGCAGCCGCAGTTCAGGCTTATCAGATTGCGTTTCTGGAAGCTGTACATCCAGAGAAGGGTGCAGGCCTGGCAGTTCTTATGGAG
CTTCAGGCTGCCCGGGGAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAACCCCGGGGTCTTCCA
GTCCACAGAGCTGAAGAAGCAGGTGGAGAGTGCCGAGCTGAAGAACCAGCGGCTCAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCG
CAAGGCCTGCTACACGCTCACCGGCTACCAGATCGACATCACCACGGAGAACCAGTACCGGCTGACCTCGCTGTACGCCGAGCACCCAGG
CGACTGCCTCATCTTCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA


Top

FusionGenePPI for CYTH3_MAD1L1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CYTH3CNKSR1, CALCOCO1, IPCEF1, GNAQ, CCDC120, SYCE1, OIP5, WDR83, GPS2, CYTIP, FOSL2, PIK3CA, MTMR7, C1orf106, TRIM25MAD1L1TEX11, NINL, NONO, FAM131C, TRIM29, AMOTL2, TUBGCP4, MAD1L1, MAD2L1, HDAC1, HDAC2, MNT, NRD1, MAD2L1BP, CDC27, COIL, UBC, METTL21C, ZW10, SIN3A, BAG5, FLNB, ZZEF1, CDC20, TPR, TRIP13, ALOX5, TSC22D3, MFAP1, PSMA1, TPM1, TPM3, RNF8, SPATA2, USP15, NEBL, LGALSL, CCHCR1, ZSCAN32, CCDC94, TSHZ3, HAUS1, CWF19L2, CLEC11A, KCNAB3, VPS28, SCARA3, IKZF3, NUDC, STK24, NTRK1, APC, FOXJ2, SNW1, CDC5L, SENP3, PTRF, ZADH2, BMP1, ASB7, HSPA8, C6orf141


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CYTH3_MAD1L1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CYTH3_MAD1L1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMAD1L1C0036341Schizophrenia1PSYGENET
TgeneMAD1L1C1336708Testicular Germ Cell Tumor1CTD_human
TgeneMAD1L1C3495559Juvenile arthritis1CTD_human