FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9183

FusionGeneSummary for CYP7B1_EPS15

check button Fusion gene summary
Fusion gene informationFusion gene name: CYP7B1_EPS15
Fusion gene ID: 9183
HgeneTgene
Gene symbol

CYP7B1

EPS15

Gene ID

9420

2060

Gene namecytochrome P450 family 7 subfamily B member 1epidermal growth factor receptor pathway substrate 15
SynonymsCBAS3|CP7B|SPG5AAF-1P|AF1P|MLLT5
Cytomap

8q12.3

1p32.3

Type of geneprotein-codingprotein-coding
Description25-hydroxycholesterol 7-alpha-hydroxylasecytochrome P450 7B1cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1oxysterol 7-alpha-hydroxylaseepidermal growth factor receptor substrate 15ALL1 fused gene from chromosome 1protein AF-1p
Modification date2018052320180522
UniProtAcc

O75881

P42566

Ensembl transtripts involved in fusion geneENST00000310193, ENST00000523954, 
ENST00000371730, ENST00000371733, 
ENST00000396122, ENST00000493793, 
Fusion gene scores* DoF score2 X 2 X 2=85 X 4 X 4=80
# samples 26
** MAII scorelog2(2/8*10)=1.32192809488736log2(6/80*10)=-0.415037499278844
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CYP7B1 [Title/Abstract] AND EPS15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneEPS15

GO:0048268

clathrin coat assembly

12807910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-PC-A5DO-01ACYP7B1chr8

65517239

-EPS15chr1

51946986

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000310193ENST00000371730CYP7B1chr8

65517239

-EPS15chr1

51946986

-
In-frameENST00000310193ENST00000371733CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5CDS-intronENST00000310193ENST00000396122CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5CDS-intronENST00000310193ENST00000493793CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5UTR-3CDSENST00000523954ENST00000371730CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5UTR-3CDSENST00000523954ENST00000371733CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5UTR-intronENST00000523954ENST00000396122CYP7B1chr8

65517239

-EPS15chr1

51946986

-
5UTR-intronENST00000523954ENST00000493793CYP7B1chr8

65517239

-EPS15chr1

51946986

-

Top

FusionProtFeatures for CYP7B1_EPS15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CYP7B1

O75881

EPS15

P42566

Oxysterol 7alpha-hydroxylase that mediates formation of7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) from 25-hydroxycholesterol (PubMed:10588945). Plays a key role in cellpositioning and movement in lymphoid tissues: 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) acts as a ligand for the Gprotein-coupled receptor GPR183/EBI2, a chemotactic receptor for anumber of lymphoid cells (By similarity).{ECO:0000250|UniProtKB:Q60991, ECO:0000269|PubMed:10588945}. Involved in cell growth regulation. May be involved inthe regulation of mitogenic signals and control of cellproliferation. Involved in the internalization of ligand-induciblereceptors of the receptor tyrosine kinase (RTK) type, inparticular EGFR. Plays a role in the assembly of clathrin-coatedpits (CCPs). Acts as a clathrin adapter required for post-Golgitrafficking. Seems to be involved in CCPs maturation includinginvagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1as DAB2-dependent cargo but not TFR seems to require associationwith DAB2. {ECO:0000269|PubMed:16903783,ECO:0000269|PubMed:18362181, ECO:0000269|PubMed:19458185,ECO:0000269|PubMed:22648170}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025173_18411897Calcium bindingNote=1
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025236_24711897Calcium bindingNote=2
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025768_85011897Compositional biasNote=Pro-rich
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025128_21611897DomainEH 2
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-02515_10411897DomainEH 1
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025160_19511897DomainEF-hand 1
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025223_25811897DomainEF-hand 2
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025224_31411897DomainEH 3
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025851_87011897DomainUIM 1
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025877_89611897DomainUIM 2
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025768_77411897MotifNote=SH3-binding
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025599_82711897RegionNote=15 X 3 AA repeats of D-P-F
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025599_60111897RepeatNote=1
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025623_62511897RepeatNote=2
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025629_63111897RepeatNote=3
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025634_63611897RepeatNote=4
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025640_64211897RepeatNote=5
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025645_64711897RepeatNote=6
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025651_65311897RepeatNote=7
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025664_66611897RepeatNote=8
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025672_67411897RepeatNote=9
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025692_69411897RepeatNote=10
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025709_71111897RepeatNote=11
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025737_73911897RepeatNote=12
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025798_80011897RepeatNote=13
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025804_80611897RepeatNote=14
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-025825_82711897RepeatNote=15

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CYP7B1_EPS15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371730_chr1_51946986_-_1163aa
MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPTLGVVLNLRKDPLRFMKTLQKQHGDTFTVLLGGKYI
TFILDPFQYQLVIKNHKQLSFRVFSNKLLEKAFSISQLQKNHDMNDELHLCTQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAEL
TPFCSSIIFEITFTTITGKVIVCDNNKFISELRDDFLKFDDKFATLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDV
LEKTTVHEDLEIGAHHLGFLWASVANTIPTMFWAMTTLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEAL
RLSSTSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPD
LILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLS
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDE
IFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNI
IGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEE
QLKEVRKKCAEEAQLARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDD
PFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGF
ADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDS

>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371733_chr1_51946986_-_1297aa
MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPTLGVVLNLRKDPLRFMKTLQKQHGDTFTVLLGGKYI
TFILDPFQYQLVIKNHKQLSFRVFSNKLLEKAFSISQLQKNHDMNDELHLCTQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAEL
TPFCSSIIFEITFTTITGKVIVCDNNKFISELRDDFLKFDDKFATLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDV
LEKTTVHEDLEIGAHHLGFLWASVANTIPTMFWAMTTLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEAL
RLSSTSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPD
LILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLS
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDE
IFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNI
IGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEE
QLKEVRKKCAEEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMK
DLENHNSQLNWCSSPHSILVNGATDTCSLSTSSSETANLNEHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELD
NNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNS
SITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPA
LPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSATPSEEDMIEWAK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371730_chr1_51946986_-_3489nt
ATGGCAGGAGAAGTGTCCGCGGCCACGGGCCGCTTTTCGCTGGAGCGGTTGGGCCTCCCGGGCCTGGCCCTCGCCGCGGCCCTGCTGCTC
CTGGCCCTCTGCTTGCTTGTCCGGCGCACCAGGAGACCCGGTGAGCCTCCATTGATAAAAGGTTGGCTTCCTTATCTTGGAGTGGTCCTG
AACTTACGAAAAGACCCCTTAAGGTTCATGAAAACACTTCAAAAGCAACATGGTGACACTTTCACAGTTCTTCTTGGTGGAAAGTACATA
ACATTTATCCTGGACCCCTTCCAGTACCAGCTAGTGATAAAAAATCATAAACAATTAAGCTTTCGAGTATTTTCTAATAAATTATTAGAG
AAAGCATTTAGCATCAGTCAGTTGCAAAAAAATCATGACATGAATGATGAGCTTCACCTCTGCTATCAATTTTTGCAAGGCAAATCTTTG
GACATACTCTTGGAAAGCATGATGCAGAATCTAAAACAAGTTTTTGAACCCCAGCTGTTAAAAACCACAAGTTGGGACACGGCAGAACTG
TATCCATTCTGCAGCTCAATAATATTTGAGATCACATTTACAACTATATATGGAAAAGTTATTGTTTGTGACAACAACAAATTTATTAGT
GAGCTAAGAGATGATTTTTTAAAATTTGATGACAAGTTTGCATATTTAGTATCCAACATACCCATTGAGCTTCTAGGAAATGTCAAGTCT
ATTAGAGAGAAAATTATAAAATGCTTCTCATCAGAAAAGTTAGCCAAGATGCAAGGATGGTCAGAAGTTTTTCAAAGCAGGCAAGATGTC
CTGGAGAAATATTATGTGCACGAGGACCTTGAAATAGGAGCACATCATTTAGGCTTTCTCTGGGCCTCTGTGGCAAACACTATTCCAACT
ATGTTCTGGGCAATGTATTATCTTCTGCGGCACCCAGAAGCTATGGCAGCAGTGCGTGACGAAATTGACCGTTTGCTGCAGTCAACAGGT
CAAAAGAAAGGGTCTGGATTTCCCATCCACCTCACCAGAGAACAATTGGACAGCCTAATCTGCCTAGAAAGCAGCATTTTTGAAGCTTTA
CGACTGTCCTCATATTCAACCACCATTCGTTTTGTTGAGGAGGATTTGACTCTCAGTTCAGAGACCGGGGACTACTGTGTGCGAAAGGGA
GACTTGGTAGCCATCTTTCCTCCAGTCCTACATGGTGACCCTGAAATCTTTGAAGCTCCAGAGTTATCAAGTGGGAATCCTGTATATGAA
AAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGAC
TTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTG
GCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTG
CTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGC
CCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAG
TTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCT
GTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAA
ATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACC
TTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGT
CAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATC
ATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAAT
AATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAG
AATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAG
CAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAA
AATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGAC
TCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGAT
CCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGAT
CCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTT
GCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTT
GCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAA
AATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTA
CCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGC
CCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCC
AACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTA

>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371733_chr1_51946986_-_3891nt
ATGGCAGGAGAAGTGTCCGCGGCCACGGGCCGCTTTTCGCTGGAGCGGTTGGGCCTCCCGGGCCTGGCCCTCGCCGCGGCCCTGCTGCTC
CTGGCCCTCTGCTTGCTTGTCCGGCGCACCAGGAGACCCGGTGAGCCTCCATTGATAAAAGGTTGGCTTCCTTATCTTGGAGTGGTCCTG
AACTTACGAAAAGACCCCTTAAGGTTCATGAAAACACTTCAAAAGCAACATGGTGACACTTTCACAGTTCTTCTTGGTGGAAAGTACATA
ACATTTATCCTGGACCCCTTCCAGTACCAGCTAGTGATAAAAAATCATAAACAATTAAGCTTTCGAGTATTTTCTAATAAATTATTAGAG
AAAGCATTTAGCATCAGTCAGTTGCAAAAAAATCATGACATGAATGATGAGCTTCACCTCTGCTATCAATTTTTGCAAGGCAAATCTTTG
GACATACTCTTGGAAAGCATGATGCAGAATCTAAAACAAGTTTTTGAACCCCAGCTGTTAAAAACCACAAGTTGGGACACGGCAGAACTG
TATCCATTCTGCAGCTCAATAATATTTGAGATCACATTTACAACTATATATGGAAAAGTTATTGTTTGTGACAACAACAAATTTATTAGT
GAGCTAAGAGATGATTTTTTAAAATTTGATGACAAGTTTGCATATTTAGTATCCAACATACCCATTGAGCTTCTAGGAAATGTCAAGTCT
ATTAGAGAGAAAATTATAAAATGCTTCTCATCAGAAAAGTTAGCCAAGATGCAAGGATGGTCAGAAGTTTTTCAAAGCAGGCAAGATGTC
CTGGAGAAATATTATGTGCACGAGGACCTTGAAATAGGAGCACATCATTTAGGCTTTCTCTGGGCCTCTGTGGCAAACACTATTCCAACT
ATGTTCTGGGCAATGTATTATCTTCTGCGGCACCCAGAAGCTATGGCAGCAGTGCGTGACGAAATTGACCGTTTGCTGCAGTCAACAGGT
CAAAAGAAAGGGTCTGGATTTCCCATCCACCTCACCAGAGAACAATTGGACAGCCTAATCTGCCTAGAAAGCAGCATTTTTGAAGCTTTA
CGACTGTCCTCATATTCAACCACCATTCGTTTTGTTGAGGAGGATTTGACTCTCAGTTCAGAGACCGGGGACTACTGTGTGCGAAAGGGA
GACTTGGTAGCCATCTTTCCTCCAGTCCTACATGGTGACCCTGAAATCTTTGAAGCTCCAGAGTTATCAAGTGGGAATCCTGTATATGAA
AAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGAC
TTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTG
GCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTG
CTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGC
CCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAG
TTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCT
GTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAA
ATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACC
TTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGT
CAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATC
ATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAAT
AATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAG
AATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAG
CAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATC
TCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAGAGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCA
GGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTACAAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAA
GATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCAGTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGC
ACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATGTTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCA
AGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGAC
AATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTC
CAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCA
GATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGC
AGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCC
TTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGT
TCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCA
CTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTT
AAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCT
ACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAG
AGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371730_chr1_51946986_-_6100nt
TCATTCAGCCTGGGAGACCACGGTGACATTCCTGTCTGCGCTGCGGGCAGGCCAGCCTCTCCGGCCCTGGACTAGGGGGCGCCGCCGAGA
GAAGCCGCCGCAGGCTGCAGAGTCGCCGACCGCGCTGTTCGCAGGCAGACCCCGGGCTGCCCACCGCGGCCTAGCGCGCGCCGGATGGCA
GGAGAAGTGTCCGCGGCCACGGGCCGCTTTTCGCTGGAGCGGTTGGGCCTCCCGGGCCTGGCCCTCGCCGCGGCCCTGCTGCTCCTGGCC
CTCTGCTTGCTTGTCCGGCGCACCAGGAGACCCGGTGAGCCTCCATTGATAAAAGGTTGGCTTCCTTATCTTGGAGTGGTCCTGAACTTA
CGAAAAGACCCCTTAAGGTTCATGAAAACACTTCAAAAGCAACATGGTGACACTTTCACAGTTCTTCTTGGTGGAAAGTACATAACATTT
ATCCTGGACCCCTTCCAGTACCAGCTAGTGATAAAAAATCATAAACAATTAAGCTTTCGAGTATTTTCTAATAAATTATTAGAGAAAGCA
TTTAGCATCAGTCAGTTGCAAAAAAATCATGACATGAATGATGAGCTTCACCTCTGCTATCAATTTTTGCAAGGCAAATCTTTGGACATA
CTCTTGGAAAGCATGATGCAGAATCTAAAACAAGTTTTTGAACCCCAGCTGTTAAAAACCACAAGTTGGGACACGGCAGAACTGTATCCA
TTCTGCAGCTCAATAATATTTGAGATCACATTTACAACTATATATGGAAAAGTTATTGTTTGTGACAACAACAAATTTATTAGTGAGCTA
AGAGATGATTTTTTAAAATTTGATGACAAGTTTGCATATTTAGTATCCAACATACCCATTGAGCTTCTAGGAAATGTCAAGTCTATTAGA
GAGAAAATTATAAAATGCTTCTCATCAGAAAAGTTAGCCAAGATGCAAGGATGGTCAGAAGTTTTTCAAAGCAGGCAAGATGTCCTGGAG
AAATATTATGTGCACGAGGACCTTGAAATAGGAGCACATCATTTAGGCTTTCTCTGGGCCTCTGTGGCAAACACTATTCCAACTATGTTC
TGGGCAATGTATTATCTTCTGCGGCACCCAGAAGCTATGGCAGCAGTGCGTGACGAAATTGACCGTTTGCTGCAGTCAACAGGTCAAAAG
AAAGGGTCTGGATTTCCCATCCACCTCACCAGAGAACAATTGGACAGCCTAATCTGCCTAGAAAGCAGCATTTTTGAAGCTTTACGACTG
TCCTCATATTCAACCACCATTCGTTTTGTTGAGGAGGATTTGACTCTCAGTTCAGAGACCGGGGACTACTGTGTGCGAAAGGGAGACTTG
GTAGCCATCTTTCCTCCAGTCCTACATGGTGACCCTGAAATCTTTGAAGCTCCAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATAC
TATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATA
CTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGT
GCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATC
AGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTG
AATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGT
GATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCA
ATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTC
CTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTA
GCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAG
TTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGA
TCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTG
GAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACT
AATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTC
AAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAG
GTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGT
TCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTT
GGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTT
GCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCT
GGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGAC
TTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTA
TTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCT
GGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAA
GAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTC
AGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAG
CAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAAT
ATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCT
GTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCA
GACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAG
CACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGT
TCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAAT
TGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAA
AAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTT
AAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATA
AAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAG
TCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTT
CAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAA
CTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCA
TGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCT
TCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTT
AATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGG
GTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTC
TTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTG
CTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAA
TTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTC
TTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTT
CAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGG
ATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATATAAATATATATG
TATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAA
AGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCT
CTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCC
CATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAG

>In-frame_CYP7B1_ENST00000310193_chr8_65517239_-_EPS15_ENST00000371733_chr1_51946986_-_6502nt
TCATTCAGCCTGGGAGACCACGGTGACATTCCTGTCTGCGCTGCGGGCAGGCCAGCCTCTCCGGCCCTGGACTAGGGGGCGCCGCCGAGA
GAAGCCGCCGCAGGCTGCAGAGTCGCCGACCGCGCTGTTCGCAGGCAGACCCCGGGCTGCCCACCGCGGCCTAGCGCGCGCCGGATGGCA
GGAGAAGTGTCCGCGGCCACGGGCCGCTTTTCGCTGGAGCGGTTGGGCCTCCCGGGCCTGGCCCTCGCCGCGGCCCTGCTGCTCCTGGCC
CTCTGCTTGCTTGTCCGGCGCACCAGGAGACCCGGTGAGCCTCCATTGATAAAAGGTTGGCTTCCTTATCTTGGAGTGGTCCTGAACTTA
CGAAAAGACCCCTTAAGGTTCATGAAAACACTTCAAAAGCAACATGGTGACACTTTCACAGTTCTTCTTGGTGGAAAGTACATAACATTT
ATCCTGGACCCCTTCCAGTACCAGCTAGTGATAAAAAATCATAAACAATTAAGCTTTCGAGTATTTTCTAATAAATTATTAGAGAAAGCA
TTTAGCATCAGTCAGTTGCAAAAAAATCATGACATGAATGATGAGCTTCACCTCTGCTATCAATTTTTGCAAGGCAAATCTTTGGACATA
CTCTTGGAAAGCATGATGCAGAATCTAAAACAAGTTTTTGAACCCCAGCTGTTAAAAACCACAAGTTGGGACACGGCAGAACTGTATCCA
TTCTGCAGCTCAATAATATTTGAGATCACATTTACAACTATATATGGAAAAGTTATTGTTTGTGACAACAACAAATTTATTAGTGAGCTA
AGAGATGATTTTTTAAAATTTGATGACAAGTTTGCATATTTAGTATCCAACATACCCATTGAGCTTCTAGGAAATGTCAAGTCTATTAGA
GAGAAAATTATAAAATGCTTCTCATCAGAAAAGTTAGCCAAGATGCAAGGATGGTCAGAAGTTTTTCAAAGCAGGCAAGATGTCCTGGAG
AAATATTATGTGCACGAGGACCTTGAAATAGGAGCACATCATTTAGGCTTTCTCTGGGCCTCTGTGGCAAACACTATTCCAACTATGTTC
TGGGCAATGTATTATCTTCTGCGGCACCCAGAAGCTATGGCAGCAGTGCGTGACGAAATTGACCGTTTGCTGCAGTCAACAGGTCAAAAG
AAAGGGTCTGGATTTCCCATCCACCTCACCAGAGAACAATTGGACAGCCTAATCTGCCTAGAAAGCAGCATTTTTGAAGCTTTACGACTG
TCCTCATATTCAACCACCATTCGTTTTGTTGAGGAGGATTTGACTCTCAGTTCAGAGACCGGGGACTACTGTGTGCGAAAGGGAGACTTG
GTAGCCATCTTTCCTCCAGTCCTACATGGTGACCCTGAAATCTTTGAAGCTCCAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATAC
TATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATA
CTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGT
GCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATC
AGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTG
AATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGT
GATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCA
ATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTC
CTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTA
GCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAG
TTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGA
TCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTG
GAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACT
AATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTC
AAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACT
TACGAAGAAGAATTGGCAAAAGCTAGAGAAGAGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAG
GCTCAGTTGGAACCTCTTCAGCAGCACCTACAAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTG
GAAAATCATAATAGTCAGTTAAATTGGTGCAGTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGC
AGCAGTGAAACAGCCAACCTTAATGAACATGTTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGT
AGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAAT
AGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCT
GATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCA
TTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATT
ACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCT
TCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCC
ACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCA
CCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTG
AATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACC
ACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAA
AGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAG
ATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAA
AACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGAT
TCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGT
GAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGC
ACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGG
TAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGA
GATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTC
CTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCT
CAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAAT
TTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTA
GTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTT
TTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTG
CTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTT
TTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTG
AATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAA
GATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTAT
TGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGAC
TCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTC
ATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGAC
TGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCA
CTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTT
CAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACC
AACATAATATTAAAGTATGTATATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGT
ATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTT
TTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTG
TAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTA
TGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGGGTTTGGGACAGCACCTGGTATAGAAT


Top

FusionGenePPI for CYP7B1_EPS15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CYP7B1UBB, GHITMEPS15RNF11, SNAP91, AGFG1, NAGPA, STON2, HGS, AP2A2, DNM2, AP2A1, EGFR, CLINT1, EPN1, SCAMP1, STAM2, GRB2, CRK, RAB11FIP2, REPS2, UBE2D1, UBE2D2, UBE2D3, UBE2H, UBE2E1, SLC6A3, PARK2, USP8, CD4, EPS15, OCLN, UBQLN1, UBC, NEDD4, GJA1, TGFB1, FCHO2, ITSN1, ITSN2, ELAVL1, RAD23A, UBQLN2, EPN3, SH3BP4, AP1B1, NUMB, SPG20, TFAP2A, ABL1, AP2B1, IQGAP1, KRT85, KRT1, KRT10, KRT2, AP2M1, KRT14, KRT86, KRT5, KRT6A, KRT16, KRT9, HSPA8, KRT35, HSPA9, KRT17, KRT33B, KRT83, BMP2K, KRT34, KRT82, NONO, KRT38, KRT75, KRT79, PRDX1, KRT36, KRT32, MAP4, HSPA1L, HSPA1B, KRT37, HSPA5, KRT73, AP2S1, NECAP2, TRAF2, MCCC2, KRT4, ACTB, KRT3, VPRBP, TUBB, HIST4H4, PCCB, KRTAP9-3, NECAP1, VSIG8, CCT3, CRKL, FN1, VCAM1, LAPTM5, ITGA4, OPTN, RABL6, EPHA2, CORO7, AGFG2, SLC25A41, AURKA, SPC25, NTRK1, TMEM17, XPO1, CAPZA2, CLTB, CLTC, DBN1, FLNA, GAK, MYH9, PPP1CB, PICALM, PDLIM7, SYNPO, MAPRE1, LIMA1, GTSE1, ANLN, MYO19, MAPK14, AP1G1, MYO6, SPOPL, SGIP1, FCHO1, CDH1, RUNDC3A, LSR, STAMBPL1, CCDC172, OXCT1, MTNR1A, RNF26


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneEPS15chr8:65517239chr1:51946986ENST00000371733-0252_33011897DAB2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CYP7B1_EPS15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CYP7B1_EPS15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCYP7B1C1849115SPASTIC PARAPLEGIA 5A, AUTOSOMAL RECESSIVE (disorder)4UNIPROT
HgeneCYP7B1C0001418Adenocarcinoma1CTD_human
HgeneCYP7B1C0008370Cholestasis1CTD_human
HgeneCYP7B1C0015695Fatty Liver1CTD_human
HgeneCYP7B1C0023772Lipid Metabolism, Inborn Errors1CTD_human
HgeneCYP7B1C0023895Liver diseases1CTD_human
HgeneCYP7B1C0033578Prostatic Neoplasms1CTD_human
HgeneCYP7B1C0037773Spastic Paraplegia, Hereditary1CTD_human
HgeneCYP7B1C2931356Spastic paraplegia type 5A, recessive1CTD_human;ORPHANET