FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9172

FusionGeneSummary for CYP4B1_PLA2G1B

check button Fusion gene summary
Fusion gene informationFusion gene name: CYP4B1_PLA2G1B
Fusion gene ID: 9172
HgeneTgene
Gene symbol

CYP4B1

PLA2G1B

Gene ID

1580

5319

Gene namecytochrome P450 family 4 subfamily B member 1phospholipase A2 group IB
SynonymsCYPIVB1|P-450HPPLA2|PLA2A|PPLA2
Cytomap

1p33

12q24.31

Type of geneprotein-codingprotein-coding
Descriptioncytochrome P450 4B1cytochrome P450, family 4, subfamily B, polypeptide 1cytochrome P450, subfamily IVB, polypeptide 1cytochrome P450-HPmicrosomal monooxygenasephospholipase A2phosphatidylcholine 2-acylhydrolase 1Bphospholipase A2, group IB (pancreas)
Modification date2018052220180519
UniProtAcc

P13584

P04054

Ensembl transtripts involved in fusion geneENST00000546128, ENST00000371923, 
ENST00000271153, ENST00000371919, 
ENST00000452782, 
ENST00000308366, 
ENST00000423423, ENST00000549767, 
Fusion gene scores* DoF score3 X 3 X 2=185 X 3 X 7=105
# samples 37
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/105*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CYP4B1 [Title/Abstract] AND PLA2G1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePLA2G1B

GO:0002227

innate immune response in mucosa

12860195

TgenePLA2G1B

GO:0006633

fatty acid biosynthetic process

1918029

TgenePLA2G1B

GO:0008284

positive regulation of cell proliferation

1918029

TgenePLA2G1B

GO:0016042

lipid catabolic process

7060561

TgenePLA2G1B

GO:0019731

antibacterial humoral response

12860195

TgenePLA2G1B

GO:0046470

phosphatidylcholine metabolic process

7060561

TgenePLA2G1B

GO:0048146

positive regulation of fibroblast proliferation

1918029

TgenePLA2G1B

GO:0050830

defense response to Gram-positive bacterium

12860195

TgenePLA2G1B

GO:0061844

antimicrobial humoral immune response mediated by antimicrobial peptide

12860195


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-75-7025-01ACYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000546128ENST00000308366CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
intron-3CDSENST00000546128ENST00000423423CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
intron-5UTRENST00000546128ENST00000549767CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000371923ENST00000308366CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000371923ENST00000423423CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
5CDS-5UTRENST00000371923ENST00000549767CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000271153ENST00000308366CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000271153ENST00000423423CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
5CDS-5UTRENST00000271153ENST00000549767CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000371919ENST00000308366CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000371919ENST00000423423CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
5CDS-5UTRENST00000371919ENST00000549767CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000452782ENST00000308366CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
In-frameENST00000452782ENST00000423423CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-
5CDS-5UTRENST00000452782ENST00000549767CYP4B1chr1

47282853

+PLA2G1Bchr12

120763823

-

Top

FusionProtFeatures for CYP4B1_PLA2G1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CYP4B1

P13584

PLA2G1B

P04054

Cytochromes P450 are a group of heme-thiolatemonooxygenases. In liver microsomes, this enzyme is involved in anNADPH-dependent electron transport pathway. It oxidizes a varietyof structurally unrelated compounds, including steroids, fattyacids, and xenobiotics. PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides, this releasesglycerophospholipids and arachidonic acid that serve as theprecursors of signal molecules. {ECO:0000269|PubMed:19297324}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CYP4B1_PLA2G1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_540aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGDPKAPDVTDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQ
DEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDD
LGKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTP
VDELDKCCQTHDNCTDQAKKLDSCKFLLDNPYTHTTSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPTNKAHKNLDTKKTCQS_

>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_462aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGDPKAPDVTDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQ
DEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDD
LGKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTP

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_539aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGDPKAPDVTDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQD
EKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDL
GKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_461aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGDPKAPDVTDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQD
EKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDL
GKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_525aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKC
TFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLD
FLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTTLTMCIKESF
RLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCT

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_447aa
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPTAHPLWFGQFIG
FLNITEPDTAKAVYSRGGRGLLVLEGPKWLQHRKLLTPGFHTDVLKPTVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKC
TFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLD
FLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTTLTMCIKESF

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_377aa
MLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQV
AHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCR
EEVREILGDQDFFQWDDLGKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFL
EYNNYGCYCGLGGSGTPVDELDKCCQTHDNCTDQAKKLDSCKFLLDNPYTHTTSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAP

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_299aa
MLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQV
AHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCR
EEVREILGDQDFFQWDDLGKMTTLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAVAAADSGISPRAVWQFRKMIKCVIPGSDPFL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1620nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGACCCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAG
TGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTG
AAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATC
TTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGC
AGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTC
ACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAG
GATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAA
CTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTAC
TGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGAT
CTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAG
CCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAA
ATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCC
GTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAAC
CCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAAC
TGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGA

>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1386nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGACCCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAG
TGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTG
AAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATC
TTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGC
AGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTC
ACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAG
GATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAA
CTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTAC
TGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGAT
CTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAG
CCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAA
ATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCC

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1617nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGACCCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAG
TGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTG
AAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATC
TTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGGGACAGCAGC
TACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACC
CCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGAT
GAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTG
TCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGC
ATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTG
GGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCT
GTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATG
ATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTG
GATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCG
TACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGC

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1383nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGACCCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAG
TGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTG
AAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATC
TTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGGGACAGCAGC
TACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACC
CCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGAT
GAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTG
TCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGC
ATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTG
GGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCT
GTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATG
ATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTG

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1575nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTG
CAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTG
GACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGC
ACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAG
CGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCAT
GACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGAC
TTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTT
GAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAG
GTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTC
CGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCC
GCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATAC
AACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTAT
GACCAGGCCAAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATC
ACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAAC

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1341nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTG
CAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTG
GACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGC
ACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAG
CGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCAT
GACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGAC
TTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTT
GAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAG
GTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTC
CGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCC
GCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATAC

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1131nt
ATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATG
AAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATG
CAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTG
GCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCAC
CTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTC
ATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGA
GAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAG
AGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTG
GCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTG
GAATACAACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAAC
TGCTATGACCAGGCCAAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCG
GCAATCACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCA

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_897nt
ATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATG
AAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATG
CAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTG
GCCCATGACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCAC
CTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTC
ATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGA
GAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAG
AGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTG
GCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1738nt
AGGTCAGATGAAGGCTAGGTGGCTGGAACTGCAACCATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCT
GGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATCCACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGG
CCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAGATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCG
TATGCCCACCCACTCTGGTTCGGACAGTTCATTGGCTTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGAC
CCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGC
AAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGG
GAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGA
AGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTG
TCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACA
GACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGAC
ATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCAT
GACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAG
ATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTAC
CCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGC
GGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTAC
GGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCC
AAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCACCTGTAGC
AGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACAC
AAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGAATATCACCTCTCAAAAGCATCACCTCTATCTGCCTCATCTCACACTGTACTCTC

>In-frame_CYP4B1_ENST00000371923_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1606nt
AGGTCAGATGAAGGCTAGGTGGCTGGAACTGCAACCATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCT
GGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATCCACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGG
CCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAGATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCG
TATGCCCACCCACTCTGGTTCGGACAGTTCATTGGCTTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGAC
CCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGC
AAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGG
GAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGA
AGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTG
TCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACA
GACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGAC
ATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCAT
GACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAG
ATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTAC
CCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGC
GGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTAC
GGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTG
CGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGAAT

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1735nt
AGGTCAGATGAAGGCTAGGTGGCTGGAACTGCAACCATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCT
GGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATCCACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGG
CCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAGATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCG
TATGCCCACCCACTCTGGTTCGGACAGTTCATTGGCTTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGAC
CCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGC
AAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGG
GAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGA
AGAGGAGACACCGGCCTGGGCCACAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCC
TTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGAC
CAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATT
CTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGAC
ACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATC
CTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCA
CCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGC
ATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGC
TGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAG
AAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCACCTGTAGCAGC
AAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAG
AACCTGGACACCAAGAAGTATTGTCAGAGTTGAATATCACCTCTCAAAAGCATCACCTCTATCTGCCTCATCTCACACTGTACTCTCCAA

>In-frame_CYP4B1_ENST00000271153_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1603nt
AGGTCAGATGAAGGCTAGGTGGCTGGAACTGCAACCATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCT
GGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATCCACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGG
CCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAGATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCG
TATGCCCACCCACTCTGGTTCGGACAGTTCATTGGCTTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGAC
CCTAAGGCCCCTGATGTGTATGACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGC
AAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGG
GAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGA
AGAGGAGACACCGGCCTGGGCCACAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCC
TTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGAC
CAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATT
CTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGAC
ACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATC
CTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCA
CCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGC
ATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGC
TGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGA
CCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGAATATC

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1657nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTG
CAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTG
GACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGC
ACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAG
CGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCAT
GACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGAC
TTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTT
GAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAG
GTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTC
CGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCC
GCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATAC
AACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTAT
GACCAGGCCAAGAAGCTGGACAGCTGTAAATTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATC
ACCTGTAGCAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAAC
AAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGAATATCACCTCTCAAAAGCATCACCTCTATCTGCCTCATCTCACAC

>In-frame_CYP4B1_ENST00000371919_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1525nt
ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCTTAGGCTTTCTCAAGCTCATC
CACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCCAGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAG
ATCCAGGAGACGGGGAGCCTGGACAAAGTGGTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGC
TTCCTGAACATCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTG
CAGCACCGCAAGCTGCTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTG
GACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGC
ACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAG
CGCCTTGTGTCCTTCCAGTACCATAATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCAT
GACCATACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGAC
TTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTT
GAAGGCCATGACACCACCACCAGTGGTATCTCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAG
GTCCGCGAGATCCTAGGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTC
CGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCC
GCCGACAGCGGCATCAGCCCTCGGGCCGTGTGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATAC
AACAACTACGGCTGCTACTGTGGCTTGGGGGGCTCAGGCACCCCCGTGGATGAACTGGACAAGCAAAAACAAAGAGTGTGAGGCCTTCAT
TTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCA

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000308366_chr12_120763823_-_1447nt
CTACTCATAAATGAGCCTCCTCTAGGAACCCCGGGTCCCTGCTTGACCTGATTGTCTCCTCCTGCAGACCCTAAGGCCCCTGATGTGTAT
GACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTT
CATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGT
AAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGC
CACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGAC
TTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGG
AAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGAT
GAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATC
TCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTC
TTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTAC
CGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTG
TGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGG
GGCTCAGGCACCCCCGTGGATGAACTGGACAAGTGCTGCCAGACACATGACAACTGCTATGACCAGGCCAAGAAGCTGGACAGCTGTAAA
TTTCTGCTGGACAACCCGTACACCCACACCTATTCATACTCGTGCTCTGGCTCGGCAATCACCTGTAGCAGCAAAAACAAAGAGTGTGAG
GCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTGCTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAG
TATTGTCAGAGTTGAATATCACCTCTCAAAAGCATCACCTCTATCTGCCTCATCTCACACTGTACTCTCCAATAAAGCACCTTGTTGAAA

>In-frame_CYP4B1_ENST00000452782_chr1_47282853_+_PLA2G1B_ENST00000423423_chr12_120763823_-_1315nt
CTACTCATAAATGAGCCTCCTCTAGGAACCCCGGGTCCCTGCTTGACCTGATTGTCTCCTCCTGCAGACCCTAAGGCCCCTGATGTGTAT
GACTTCTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTGCTCACACCTGGCTTT
CATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCATGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGT
AAGTCCTTTGACATCTTCTGCGATGTGGGTCACATGGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGC
CACAGCAGGGACAGCAGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATAATGAC
TTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCATACAGACCAGGTCATCAGGGAGCGG
AAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAACCGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGAT
GAAGATGACATCAAACTGTCAGATGCAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATC
TCCTGGTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTAGGGGACCAGGACTTC
TTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGAGCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTAC
CGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGGCCGGTCTCTACCTGCAGTGGCCGCCGCCGACAGCGGCATCAGCCCTCGGGCCGTG
TGGCAGTTCCGCAAAATGATCAAGTGCGTGATCCCGGGGAGTGACCCCTTCTTGGAATACAACAACTACGGCTGCTACTGTGGCTTGGGG
GGCTCAGGCACCCCCGTGGATGAACTGGACAAGCAAAAACAAAGAGTGTGAGGCCTTCATTTGCAACTGCGACCGCAACGCTGCCATCTG
CTTTTCAAAAGCTCCATATAACAAGGCACACAAGAACCTGGACACCAAGAAGTATTGTCAGAGTTGAATATCACCTCTCAAAAGCATCAC


Top

FusionGenePPI for CYP4B1_PLA2G1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CYP4B1PKLRPLA2G1BPLA2G2A, SOCS2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CYP4B1_PLA2G1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePLA2G1BP04054DB00795SulfasalazinePhospholipase A2small moleculeapproved
TgenePLA2G1BP04054DB02659Cholic AcidPhospholipase A2small moleculeapproved
TgenePLA2G1BP04054DB04552Niflumic AcidPhospholipase A2small moleculeapproved

Top

RelatedDiseases for CYP4B1_PLA2G1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCYP4B1C0005695Bladder Neoplasm1CTD_human
TgenePLA2G1BC0005586Bipolar Disorder5PSYGENET
TgenePLA2G1BC0036341Schizophrenia3PSYGENET
TgenePLA2G1BC0525045Mood Disorders2PSYGENET
TgenePLA2G1BC0338715Drug-induced depressive state1PSYGENET