FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9122

FusionGeneSummary for CYFIP1_FAM189A1

check button Fusion gene summary
Fusion gene informationFusion gene name: CYFIP1_FAM189A1
Fusion gene ID: 9122
HgeneTgene
Gene symbol

CYFIP1

FAM189A1

Gene ID

23191

23359

Gene namecytoplasmic FMR1 interacting protein 1family with sequence similarity 189 member A1
SynonymsP140SRA-1|SHYC|SRA-1|SRA1TMEM228
Cytomap

15q11.2

15q13.1

Type of geneprotein-codingprotein-coding
Descriptioncytoplasmic FMR1-interacting protein 1cytoplasmic FMRP interacting protein 1selective hybridizing clonespecifically Rac1-associated protein 1protein FAM189A1transmembrane protein 228
Modification date2018052320180519
UniProtAcc

Q7L576

O60320

Ensembl transtripts involved in fusion geneENST00000313077, ENST00000560848, 
ENST00000435939, 
ENST00000261275, 
ENST00000560050, 
Fusion gene scores* DoF score6 X 6 X 3=1082 X 2 X 2=8
# samples 52
** MAII scorelog2(5/108*10)=-1.11103131238874
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: CYFIP1 [Title/Abstract] AND FAM189A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A7-A26F-01ACYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000313077ENST00000261275CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
5CDS-5UTRENST00000313077ENST00000560050CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
In-frameENST00000560848ENST00000261275CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
5CDS-5UTRENST00000560848ENST00000560050CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
In-frameENST00000435939ENST00000261275CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-
5CDS-5UTRENST00000435939ENST00000560050CYFIP1chr15

23000243

-FAM189A1chr15

29674035

-

Top

FusionProtFeatures for CYFIP1_FAM189A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CYFIP1

Q7L576

FAM189A1

O60320

Component of the CYFIP1-EIF4E-FMR1 complex which bindsto the mRNA cap and mediates translational repression. In theCYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4Eand FMR1. Promotes the translation repression activity of FMR1 inbrain probably by mediating its association with EIF4E and mRNA(By similarity). Regulates formation of membrane ruffles andlamellipodia. Plays a role in axon outgrowth. Binds to F-actin butnot to RNA. Part of the WAVE complex that regulates actin filamentreorganization via its interaction with the Arp2/3 complex. Actinremodeling activity is regulated by RAC1. Regulator of epithelialmorphogenesis. As component of the WAVE1 complex, required forBDNF-NTRK2 endocytic trafficking and signaling from earlyendosomes (By similarity). May act as an invasion suppressor incancers. {ECO:0000250|UniProtKB:Q7TMB8,ECO:0000269|PubMed:16260607, ECO:0000269|PubMed:19524508,ECO:0000269|PubMed:21107423, ECO:0000269|PubMed:9417078}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM189A1chr15:23000243chr15:29674035ENST00000261275-011242_39173540Compositional biasNote=Pro-rich
TgeneFAM189A1chr15:23000243chr15:29674035ENST00000261275-011176_19673540TransmembraneHelical
TgeneFAM189A1chr15:23000243chr15:29674035ENST00000261275-01189_10973540TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM189A1chr15:23000243chr15:29674035ENST00000261275-01131_5173540TransmembraneHelical
TgeneFAM189A1chr15:23000243chr15:29674035ENST00000261275-01165_8573540TransmembraneHelical


Top

FusionGeneSequence for CYFIP1_FAM189A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CYFIP1_ENST00000313077_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_1666aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQETAVMLYTWRSCS
RAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMTLTPSEKHMLLKVMGFG
LYLMDGSVSNITKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARTIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVTSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFA
LVEVIAMIKGLQVLMGRMESVFNHAIRHTVTAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLEL
TMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFATTKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMTKSLELAIGRFESEDLTSIVELDGLLEINRMTHK
LLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNTDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQTLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELK
TVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQ
QRRFAVLDFCYHLLKVQKHDGKDEIIKNVVLLSGLIGVVSWKRPLSLVITFFMLLSAVCVMLNLAGSILSCQNAQLVNSLEGCQLIKFDS
VEVCVCCELQHQSSGCSNLGETLKLNPLQENCNAVRLTLKDLLFSVCALNVLSTIVCALATAMCCMQMVSSDVLQMFLPQRSHPANPTCV
TPHGTVLHQTLDFDEFIPPLPPPPTYPPEYTCTPSTEAQRGLHLDFAPSPFGTLTDVAINSPGLLTPAELPPPYEAVVGQPPASQVTSIG
QQVAESSSGDPNTSAGFSTPVPADSTSLLVSEGTATPGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGSQVQPGPGRVSRSTSDPTLC
TSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSRSATAACRAQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKATADARVLVA

>In-frame_CYFIP1_ENST00000560848_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_1666aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQETAVMLYTWRSCS
RAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMTLTPSEKHMLLKVMGFG
LYLMDGSVSNITKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARTIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVTSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFA
LVEVIAMIKGLQVLMGRMESVFNHAIRHTVTAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLEL
TMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFATTKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMTKSLELAIGRFESEDLTSIVELDGLLEINRMTHK
LLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNTDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQTLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELK
TVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQ
QRRFAVLDFCYHLLKVQKHDGKDEIIKNVVLLSGLIGVVSWKRPLSLVITFFMLLSAVCVMLNLAGSILSCQNAQLVNSLEGCQLIKFDS
VEVCVCCELQHQSSGCSNLGETLKLNPLQENCNAVRLTLKDLLFSVCALNVLSTIVCALATAMCCMQMVSSDVLQMFLPQRSHPANPTCV
TPHGTVLHQTLDFDEFIPPLPPPPTYPPEYTCTPSTEAQRGLHLDFAPSPFGTLTDVAINSPGLLTPAELPPPYEAVVGQPPASQVTSIG
QQVAESSSGDPNTSAGFSTPVPADSTSLLVSEGTATPGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGSQVQPGPGRVSRSTSDPTLC
TSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSRSATAACRAQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKATADARVLVA

>In-frame_CYFIP1_ENST00000435939_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_1235aa
MAESLGSAELLRQLKSLGMERLLHAVNTFLRQSCTYLPLLTFGGKTSFVSLDVTGTEANCSATSCSFPKAAATWPRRQAPGPLGELVRGP
PDQGVAEQSFSHGLFEFGITNVPCIFSPPQMFPWIIQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSET
LQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQ
FVYKLADQIFATTKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMTKSLELAIGRFESED
LTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNTDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQP
NAQPQTLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPG
ILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVP
LIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQ
CFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVVLLSGLIGVVSWKRPLSLVITFFMLLSAVCVMLNLAGSILSC
QNAQLVNSLEGCQLIKFDSVEVCVCCELQHQSSGCSNLGETLKLNPLQENCNAVRLTLKDLLFSVCALNVLSTIVCALATAMCCMQMVSS
DVLQMFLPQRSHPANPTCVTPHGTVLHQTLDFDEFIPPLPPPPTYPPEYTCTPSTEAQRGLHLDFAPSPFGTLTDVAINSPGLLTPAELP
PPYEAVVGQPPASQVTSIGQQVAESSSGDPNTSAGFSTPVPADSTSLLVSEGTATPGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGS
QVQPGPGRVSRSTSDPTLCTSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSRSATAACRAQLSPAGDPDTWKTDQRPTPEPFPATSKE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CYFIP1_ENST00000313077_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_4998nt
ATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGGAGCTGCCCCTGCCCGACCAGCAGCCCTGCATCGAG
CCCCCGCCATCCTCGCTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTTACTGGCATCGCAAGATACATT
GAACAAGCCACCGTCCACTCTAGCATGAACGAGATGCTGGAGGAGGGCCAAGAATATGCTGTCATGCTGTACACCTGGAGGAGCTGCTCC
CGGGCCATCCCACAGGTGAAATGTAACGAGCAGCCTAACAGAGTGGAAATCTACGAGAAAACCGTGGAGGTTCTGGAGCCTGAGGTCACA
AAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTGAGCGTTTCTGCGGGGAAGTGAGGCGCCTGTGCCATGCCGAGAGGAGGAAG
GACTTCGTGTCAGAAGCCTACCTGATCACACTGGGCAAATTCATCAACATGTTCGCTGTGCTGGACGAGCTGAAGAACATGAAGTGCAGT
GTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGGCAGATCCACAGTCCATCCAGGAATCGCAGAATCTG
TCCATGTTCCTGGCCAATCATAACAAGATCACACAGTCTCTGCAGCAGCAGCTCGAAGTGATTTCTGGCTACGAAGAGCTCCTGGCAGAT
ATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCATGGGATTTGGT
CTGTACCTGATGGATGGGAGTGTCAGTAACATCTATAAGTTGGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
CAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATATCAAGACCAGCGCCCACTACGAGGAAAATAAATCT
CGATGGACGTGCACATCCTCCGGCAGCAGCCCTCAGTACAACATCTGCGAGCAGATGATCCAGATCCGCGAGGACCACATGCGCTTCATT
TCGGAGCTGGCGCGCTACAGCAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGGAGGCCCAGAAGACGGACGCGGAGTACCGCAAGCTC
TTCGACCTGGCGCTGCAGGGCCTGCAGCTGTTGTCGCAGTGGAGCGCGCACGTGATGGAAGTGTATTCCTGGAAGCTTGTGCACCCCACC
GACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAGAGTACGAGCGTGCCACGCGCTACAACTACACCAGCGAGGAGAAGTTTGCC
CTAGTGGAGGTGATCGCCATGATCAAAGGCCTGCAGGTGCTGATGGGCAGGATGGAGAGCGTGTTCAACCACGCCATCCGGCACACCGTC
TATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGGCCATCAAGAAGAAGAAGAACGTCATCCAGAGTGTC
CTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACGGGGCATGAGCCCTTCAATGACCCAGCCTTGCGGGGCGAGAAGGACCCCAAG
AGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGCTTTACATGGTGAGAACCATGCTAGAGTCCCTCATT
GCAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTC
TTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTG
ACCATGGGCAGGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATG
ATGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCCTGTACGACGAA
ATTGAGGCCGAGGTGAATCTATGTTTTGACCAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGT
TTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTG
AAGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTA
GAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGCCTGTTGGAAATCAACCGCATGACCCACAAG
CTGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACGGGAGGATCACC
CTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGACAGTGTTACCA
TTTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGC
ATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATG
GAGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGC
CGCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAG
ACGGTGTGCTTCCAGAACCTGCGGGAGGTGGGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGT
GACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAATGAAAAGACTA
GAATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTG
CTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATCCGGAGCTTTCTGGATGACCCCATCTGGCGC
GGGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTGTCTACTGCATT
CCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTACTTCTTGGGCAG
CAGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGGTG
CTGCTGTCGGGACTCATAGGTGTCGTCTCCTGGAAGAGGCCTCTCTCCCTTGTGATAACCTTTTTCATGCTGCTTTCTGCAGTGTGTGTA
ATGCTGAATTTGGCTGGTTCAATTCTCTCTTGTCAGAATGCTCAGCTAGTCAACTCCCTAGAAGGCTGCCAGTTGATTAAGTTTGACAGT
GTGGAGGTGTGTGTCTGCTGTGAGCTGCAGCACCAGTCGTCCGGCTGCAGCAACCTCGGGGAGACGCTGAAGCTGAACCCGCTGCAGGAG
AACTGCAACGCTGTGAGGCTGACCTTGAAGGATCTCCTCTTCAGCGTGTGTGCCCTCAACGTCCTGTCCACTATCGTGTGTGCGCTGGCC
ACAGCCATGTGCTGTATGCAGATGGTCTCCTCCGATGTCCTGCAGATGTTCCTTCCGCAGAGGTCACATCCTGCCAACCCCACCTGCGTG
ACTCCTCACGGCACCGTTCTCCACCAGACCCTGGATTTCGACGAGTTCATCCCCCCACTCCCGCCTCCACCCTATTACCCCCCAGAGTAC
ACCTGCACACCGTCCACTGAGGCCCAGAGGGGCCTCCACCTGGACTTTGCTCCGTCTCCATTCGGCACTTTGTATGACGTGGCCATCAAT
AGCCCCGGCCTGCTCTATCCTGCTGAGCTCCCCCCTCCGTACGAGGCGGTGGTGGGCCAGCCCCCTGCCAGCCAGGTTACAAGTATAGGT
CAGCAGGTGGCCGAGTCCAGCTCCGGGGACCCAAACACCAGTGCTGGCTTCAGCACTCCAGTACCAGCTGACAGCACAAGCCTCCTGGTG
TCCGAGGGCACTGCTACGCCAGGTTCCAGCCCATCCCCCGATGGCCCTGTGGGCGCCCCAGCACCCTCCGAACCTGCCCTTCCCCCTGGC
CATGTGTCTCCAGAGGATCCTGGCATGGGCTCACAGGTGCAGCCAGGTCCCGGGCGTGTGTCCCGCTCCACCAGCGACCCCACCTTGTGC
ACATCTAGCATGGCAGGCGATGCCTCTTCACACAGGCCGTCGTGTAGCCAGGACCTGGAAGCGGGACTGTCTGAGGCTGTGCCTGGGAGC
GCTTCCATGTCTCGCTCTGCCACGGCTGCCTGTCGGGCCCAGCTTTCACCAGCGGGGGACCCAGATACCTGGAAAACTGACCAACGGCCA
ACACCAGAGCCCTTCCCAGCGACCTCCAAAGAGCGGCCACGCTCTTTAGTGGACAGCAAGGCCTATGCGGATGCCAGGGTTTTGGTGGCC
AAGTTTTTGGAACACTCACACTGTGCCCTCCCCACCGAGGCACAGCACATGGTGGGTGCCATGCGCTTGGCTGTCACCAACGAGGAGCGC

>In-frame_CYFIP1_ENST00000560848_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_4998nt
ATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGGAGCTGCCCCTGCCCGACCAGCAGCCCTGCATCGAG
CCCCCGCCATCCTCGCTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTTACTGGCATCGCAAGATACATT
GAACAAGCCACCGTCCACTCTAGCATGAACGAGATGCTGGAGGAGGGCCAAGAATATGCTGTCATGCTGTACACCTGGAGGAGCTGCTCC
CGGGCCATCCCACAGGTGAAATGTAACGAGCAGCCTAACAGAGTGGAAATCTACGAGAAAACCGTGGAGGTTCTGGAGCCTGAGGTCACA
AAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTGAGCGTTTCTGCGGGGAAGTGAGGCGCCTGTGCCATGCCGAGAGGAGGAAG
GACTTCGTGTCAGAAGCCTACCTGATCACACTGGGCAAATTCATCAACATGTTCGCTGTGCTGGACGAGCTGAAGAACATGAAGTGCAGT
GTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGGCAGATCCACAGTCCATCCAGGAATCGCAGAATCTG
TCCATGTTCCTGGCCAATCATAACAAGATCACACAGTCTCTGCAGCAGCAGCTCGAAGTGATTTCTGGCTACGAAGAGCTCCTGGCAGAT
ATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCATGGGATTTGGT
CTGTACCTGATGGATGGGAGTGTCAGTAACATCTATAAGTTGGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
CAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATATCAAGACCAGCGCCCACTACGAGGAAAATAAATCT
CGATGGACGTGCACATCCTCCGGCAGCAGCCCTCAGTACAACATCTGCGAGCAGATGATCCAGATCCGCGAGGACCACATGCGCTTCATT
TCGGAGCTGGCGCGCTACAGCAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGGAGGCCCAGAAGACGGACGCGGAGTACCGCAAGCTC
TTCGACCTGGCGCTGCAGGGCCTGCAGCTGTTGTCGCAGTGGAGCGCGCACGTGATGGAAGTGTATTCCTGGAAGCTTGTGCACCCCACC
GACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAGAGTACGAGCGTGCCACGCGCTACAACTACACCAGCGAGGAGAAGTTTGCC
CTAGTGGAGGTGATCGCCATGATCAAAGGCCTGCAGGTGCTGATGGGCAGGATGGAGAGCGTGTTCAACCACGCCATCCGGCACACCGTC
TATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGGCCATCAAGAAGAAGAAGAACGTCATCCAGAGTGTC
CTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACGGGGCATGAGCCCTTCAATGACCCAGCCTTGCGGGGCGAGAAGGACCCCAAG
AGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGCTTTACATGGTGAGAACCATGCTAGAGTCCCTCATT
GCAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTC
TTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTG
ACCATGGGCAGGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATG
ATGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCCTGTACGACGAA
ATTGAGGCCGAGGTGAATCTATGTTTTGACCAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGT
TTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTG
AAGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTA
GAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGCCTGTTGGAAATCAACCGCATGACCCACAAG
CTGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACGGGAGGATCACC
CTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGACAGTGTTACCA
TTTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGC
ATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATG
GAGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGC
CGCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAG
ACGGTGTGCTTCCAGAACCTGCGGGAGGTGGGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGT
GACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAATGAAAAGACTA
GAATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTG
CTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATCCGGAGCTTTCTGGATGACCCCATCTGGCGC
GGGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTGTCTACTGCATT
CCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTACTTCTTGGGCAG
CAGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGGTG
CTGCTGTCGGGACTCATAGGTGTCGTCTCCTGGAAGAGGCCTCTCTCCCTTGTGATAACCTTTTTCATGCTGCTTTCTGCAGTGTGTGTA
ATGCTGAATTTGGCTGGTTCAATTCTCTCTTGTCAGAATGCTCAGCTAGTCAACTCCCTAGAAGGCTGCCAGTTGATTAAGTTTGACAGT
GTGGAGGTGTGTGTCTGCTGTGAGCTGCAGCACCAGTCGTCCGGCTGCAGCAACCTCGGGGAGACGCTGAAGCTGAACCCGCTGCAGGAG
AACTGCAACGCTGTGAGGCTGACCTTGAAGGATCTCCTCTTCAGCGTGTGTGCCCTCAACGTCCTGTCCACTATCGTGTGTGCGCTGGCC
ACAGCCATGTGCTGTATGCAGATGGTCTCCTCCGATGTCCTGCAGATGTTCCTTCCGCAGAGGTCACATCCTGCCAACCCCACCTGCGTG
ACTCCTCACGGCACCGTTCTCCACCAGACCCTGGATTTCGACGAGTTCATCCCCCCACTCCCGCCTCCACCCTATTACCCCCCAGAGTAC
ACCTGCACACCGTCCACTGAGGCCCAGAGGGGCCTCCACCTGGACTTTGCTCCGTCTCCATTCGGCACTTTGTATGACGTGGCCATCAAT
AGCCCCGGCCTGCTCTATCCTGCTGAGCTCCCCCCTCCGTACGAGGCGGTGGTGGGCCAGCCCCCTGCCAGCCAGGTTACAAGTATAGGT
CAGCAGGTGGCCGAGTCCAGCTCCGGGGACCCAAACACCAGTGCTGGCTTCAGCACTCCAGTACCAGCTGACAGCACAAGCCTCCTGGTG
TCCGAGGGCACTGCTACGCCAGGTTCCAGCCCATCCCCCGATGGCCCTGTGGGCGCCCCAGCACCCTCCGAACCTGCCCTTCCCCCTGGC
CATGTGTCTCCAGAGGATCCTGGCATGGGCTCACAGGTGCAGCCAGGTCCCGGGCGTGTGTCCCGCTCCACCAGCGACCCCACCTTGTGC
ACATCTAGCATGGCAGGCGATGCCTCTTCACACAGGCCGTCGTGTAGCCAGGACCTGGAAGCGGGACTGTCTGAGGCTGTGCCTGGGAGC
GCTTCCATGTCTCGCTCTGCCACGGCTGCCTGTCGGGCCCAGCTTTCACCAGCGGGGGACCCAGATACCTGGAAAACTGACCAACGGCCA
ACACCAGAGCCCTTCCCAGCGACCTCCAAAGAGCGGCCACGCTCTTTAGTGGACAGCAAGGCCTATGCGGATGCCAGGGTTTTGGTGGCC
AAGTTTTTGGAACACTCACACTGTGCCCTCCCCACCGAGGCACAGCACATGGTGGGTGCCATGCGCTTGGCTGTCACCAACGAGGAGCGC

>In-frame_CYFIP1_ENST00000435939_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_3705nt
ATGGCCGAGTCCTTGGGCTCTGCCGAGCTGCTCAGGCAGCTCAAGTCTCTGGGCATGGAGAGGCTCTTGCATGCGGTTAACACGTTTCTG
AGGCAGTCGTGCACCTACCTACCCCTTTTAACCTTTGGTGGTAAGACATCATTTGTTTCTCTTGACGTTTATGGCACGGAGGCGAACTGC
TCCGCTACAAGTTGTTCTTTCCCCAAAGCAGCAGCAACGTGGCCGCGTAGACAGGCACCCGGACCCCTCGGGGAGCTGGTGCGGGGCCCT
CCCGACCAGGGCGTAGCGGAGCAGTCCTTCTCTCATGGGCTTTTTGAGTTTGGCATAACTAATGTACCATGTATATTTTCTCCCCCACAA
ATGTTTCCTTGGATAATCCAGCTTTACATGGTGAGAACCATGCTAGAGTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCTTGAGA
AGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTCTTCTACACTCACTTGATAAATTTCAGTGAAACG
CTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGCAGGAGGATCCAGTTCCCCATTGAG
ATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATGATGGAGTACGTGCTCTACTCCCTGGACCTGTAC
AATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCCTGTACGACGAAATTGAGGCCGAGGTGAATCTATGTTTTGACCAA
TTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGTTTGCTTCTTGATAAACGGTTACGATCAGAATGC
AAGAATCAGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTGAAGCAGAGGCATGTGCAGCTCCTCGGCAGATCA
ATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTAGAACTGGCGATTGGACGATTTGAAAGTGAAGAT
TTGACCTCCATAGTTGAGCTGGATGGCCTGTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCCGGTACCTGACGCTGGACGGCTTC
GACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACGGGAGGATCACCCTGCACGTCTTCTGGGAGCTCAACTATGACTTC
CTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGACAGTGTTACCATTTTCTCAGGAATTTCAAAGAGATAAGCAGCCT
AATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGCATTTACGGCAGCTACCGGAACTTCGTGGGACCT
CCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATGGAGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTG
CAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGCCGCCTGCCCCGGCACGAGTACGGCTCTCCTGGT
ATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAGACGGTGTGCTTCCAGAACCTGCGGGAGGTGGGG
AACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGTGACCTGCTGCACGCGGCTCCTTTCCAGAACATC
TTGCCGCGAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCGCTGCATCTTGTCCCA
CTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTGCTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCC
ATGTTTGAGGTCATCCTGACACGGATCCGGAGCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAATGGGGTCATGCATGTG
GACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTGTCTACTGCATTCCCGTGGGGACACACGAGTTCACAGTCGAGCAG
TGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTACTTCTTGGGCAGCAGCGGCGTTTTGCTGTGCTGGATTTCTGCTAC
CATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGGTGCTGCTGTCGGGACTCATAGGTGTCGTCTCCTGG
AAGAGGCCTCTCTCCCTTGTGATAACCTTTTTCATGCTGCTTTCTGCAGTGTGTGTAATGCTGAATTTGGCTGGTTCAATTCTCTCTTGT
CAGAATGCTCAGCTAGTCAACTCCCTAGAAGGCTGCCAGTTGATTAAGTTTGACAGTGTGGAGGTGTGTGTCTGCTGTGAGCTGCAGCAC
CAGTCGTCCGGCTGCAGCAACCTCGGGGAGACGCTGAAGCTGAACCCGCTGCAGGAGAACTGCAACGCTGTGAGGCTGACCTTGAAGGAT
CTCCTCTTCAGCGTGTGTGCCCTCAACGTCCTGTCCACTATCGTGTGTGCGCTGGCCACAGCCATGTGCTGTATGCAGATGGTCTCCTCC
GATGTCCTGCAGATGTTCCTTCCGCAGAGGTCACATCCTGCCAACCCCACCTGCGTGACTCCTCACGGCACCGTTCTCCACCAGACCCTG
GATTTCGACGAGTTCATCCCCCCACTCCCGCCTCCACCCTATTACCCCCCAGAGTACACCTGCACACCGTCCACTGAGGCCCAGAGGGGC
CTCCACCTGGACTTTGCTCCGTCTCCATTCGGCACTTTGTATGACGTGGCCATCAATAGCCCCGGCCTGCTCTATCCTGCTGAGCTCCCC
CCTCCGTACGAGGCGGTGGTGGGCCAGCCCCCTGCCAGCCAGGTTACAAGTATAGGTCAGCAGGTGGCCGAGTCCAGCTCCGGGGACCCA
AACACCAGTGCTGGCTTCAGCACTCCAGTACCAGCTGACAGCACAAGCCTCCTGGTGTCCGAGGGCACTGCTACGCCAGGTTCCAGCCCA
TCCCCCGATGGCCCTGTGGGCGCCCCAGCACCCTCCGAACCTGCCCTTCCCCCTGGCCATGTGTCTCCAGAGGATCCTGGCATGGGCTCA
CAGGTGCAGCCAGGTCCCGGGCGTGTGTCCCGCTCCACCAGCGACCCCACCTTGTGCACATCTAGCATGGCAGGCGATGCCTCTTCACAC
AGGCCGTCGTGTAGCCAGGACCTGGAAGCGGGACTGTCTGAGGCTGTGCCTGGGAGCGCTTCCATGTCTCGCTCTGCCACGGCTGCCTGT
CGGGCCCAGCTTTCACCAGCGGGGGACCCAGATACCTGGAAAACTGACCAACGGCCAACACCAGAGCCCTTCCCAGCGACCTCCAAAGAG
CGGCCACGCTCTTTAGTGGACAGCAAGGCCTATGCGGATGCCAGGGTTTTGGTGGCCAAGTTTTTGGAACACTCACACTGTGCCCTCCCC
ACCGAGGCACAGCACATGGTGGGTGCCATGCGCTTGGCTGTCACCAACGAGGAGCGCCTCGAGGAGGAGGCCGTCTTCGGCGCTGACGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CYFIP1_ENST00000313077_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_8208nt
CGGGAGGAAGGGGAGGAGGCCGAGTGTTTCCTGGCGCATTCCCGGCCAGCCCGAGTGACTCACTCGGCCAAGGAAACTCCCAGGGCCCGC
CCAGGACCCCCAAGCCGCCGCGGACGCAGCCCAGGATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGG
AGCTGCCCCTGCCCGACCAGCAGCCCTGCATCGAGCCCCCGCCATCCTCGCTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACA
GAAATGCATTTGTTACTGGCATCGCAAGATACATTGAACAAGCCACCGTCCACTCTAGCATGAACGAGATGCTGGAGGAGGGCCAAGAAT
ATGCTGTCATGCTGTACACCTGGAGGAGCTGCTCCCGGGCCATCCCACAGGTGAAATGTAACGAGCAGCCTAACAGAGTGGAAATCTACG
AGAAAACCGTGGAGGTTCTGGAGCCTGAGGTCACAAAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTGAGCGTTTCTGCGGGG
AAGTGAGGCGCCTGTGCCATGCCGAGAGGAGGAAGGACTTCGTGTCAGAAGCCTACCTGATCACACTGGGCAAATTCATCAACATGTTCG
CTGTGCTGGACGAGCTGAAGAACATGAAGTGCAGTGTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGG
CAGATCCACAGTCCATCCAGGAATCGCAGAATCTGTCCATGTTCCTGGCCAATCATAACAAGATCACACAGTCTCTGCAGCAGCAGCTCG
AAGTGATTTCTGGCTACGAAGAGCTCCTGGCAGATATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTG
AGAAACACATGCTTCTCAAAGTCATGGGATTTGGTCTGTACCTGATGGATGGGAGTGTCAGTAACATCTATAAGTTGGATGCCAAGAAAA
GAATAAACTTATCCAAAATCGACAAGTACTTCAAGCAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATA
TCAAGACCAGCGCCCACTACGAGGAAAATAAATCTCGATGGACGTGCACATCCTCCGGCAGCAGCCCTCAGTACAACATCTGCGAGCAGA
TGATCCAGATCCGCGAGGACCACATGCGCTTCATTTCGGAGCTGGCGCGCTACAGCAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGG
AGGCCCAGAAGACGGACGCGGAGTACCGCAAGCTCTTCGACCTGGCGCTGCAGGGCCTGCAGCTGTTGTCGCAGTGGAGCGCGCACGTGA
TGGAAGTGTATTCCTGGAAGCTTGTGCACCCCACCGACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAGAGTACGAGCGTGCCA
CGCGCTACAACTACACCAGCGAGGAGAAGTTTGCCCTAGTGGAGGTGATCGCCATGATCAAAGGCCTGCAGGTGCTGATGGGCAGGATGG
AGAGCGTGTTCAACCACGCCATCCGGCACACCGTCTATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGG
CCATCAAGAAGAAGAAGAACGTCATCCAGAGTGTCCTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACGGGGCATGAGCCCTTCA
ATGACCCAGCCTTGCGGGGCGAGAAGGACCCCAAGAGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGC
TTTACATGGTGAGAACCATGCTAGAGTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCA
TATTGGACATAGAAAAATTTCATCGAGAGTCATTCTTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTT
CGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGCAGGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGA
CGGACCACATCCTGGAGACCAAGGAGGCATCGATGATGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGC
TCACCAGGTTCAACAAGCAGTTCCTGTACGACGAAATTGAGGCCGAGGTGAATCTATGTTTTGACCAATTTGTTTACAAGCTAGCAGACC
AGATATTTGCCTATTATAAGGTTATGGCAGGAAGTTTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCC
ACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTGAAGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCTGATCA
CCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTAGAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGG
ATGGCCTGTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCA
ACCACAACGTGTCAGCGCCCTACGGGAGGATCACCCTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACG
GCTCTACCAACCGGTTTGTTCGGACAGTGTTACCATTTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGC
ATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGCATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCC
GGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATGGAGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACG
TGAAGACGCTGATGGAGGTGATGCCCAAGATCTGCCGCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACC
AGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAGACGGTGTGCTTCCAGAACCTGCGGGAGGTGGGGAACGCCATCCTCTTCTGCCTGC
TCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGTGACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAG
AGGGGGAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGGGACCC
CTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTGCTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACAC
GGATCCGGAGCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACA
GACTGTGGAGTGCCATGCAGTTTGTCTACTGCATTCCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACT
GGGCTGGCTGTATGATCATCGTACTTCTTGGGCAGCAGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAAC
ATGATGGCAAAGATGAGATTATTAAAAATGTGGTGCTGCTGTCGGGACTCATAGGTGTCGTCTCCTGGAAGAGGCCTCTCTCCCTTGTGA
TAACCTTTTTCATGCTGCTTTCTGCAGTGTGTGTAATGCTGAATTTGGCTGGTTCAATTCTCTCTTGTCAGAATGCTCAGCTAGTCAACT
CCCTAGAAGGCTGCCAGTTGATTAAGTTTGACAGTGTGGAGGTGTGTGTCTGCTGTGAGCTGCAGCACCAGTCGTCCGGCTGCAGCAACC
TCGGGGAGACGCTGAAGCTGAACCCGCTGCAGGAGAACTGCAACGCTGTGAGGCTGACCTTGAAGGATCTCCTCTTCAGCGTGTGTGCCC
TCAACGTCCTGTCCACTATCGTGTGTGCGCTGGCCACAGCCATGTGCTGTATGCAGATGGTCTCCTCCGATGTCCTGCAGATGTTCCTTC
CGCAGAGGTCACATCCTGCCAACCCCACCTGCGTGACTCCTCACGGCACCGTTCTCCACCAGACCCTGGATTTCGACGAGTTCATCCCCC
CACTCCCGCCTCCACCCTATTACCCCCCAGAGTACACCTGCACACCGTCCACTGAGGCCCAGAGGGGCCTCCACCTGGACTTTGCTCCGT
CTCCATTCGGCACTTTGTATGACGTGGCCATCAATAGCCCCGGCCTGCTCTATCCTGCTGAGCTCCCCCCTCCGTACGAGGCGGTGGTGG
GCCAGCCCCCTGCCAGCCAGGTTACAAGTATAGGTCAGCAGGTGGCCGAGTCCAGCTCCGGGGACCCAAACACCAGTGCTGGCTTCAGCA
CTCCAGTACCAGCTGACAGCACAAGCCTCCTGGTGTCCGAGGGCACTGCTACGCCAGGTTCCAGCCCATCCCCCGATGGCCCTGTGGGCG
CCCCAGCACCCTCCGAACCTGCCCTTCCCCCTGGCCATGTGTCTCCAGAGGATCCTGGCATGGGCTCACAGGTGCAGCCAGGTCCCGGGC
GTGTGTCCCGCTCCACCAGCGACCCCACCTTGTGCACATCTAGCATGGCAGGCGATGCCTCTTCACACAGGCCGTCGTGTAGCCAGGACC
TGGAAGCGGGACTGTCTGAGGCTGTGCCTGGGAGCGCTTCCATGTCTCGCTCTGCCACGGCTGCCTGTCGGGCCCAGCTTTCACCAGCGG
GGGACCCAGATACCTGGAAAACTGACCAACGGCCAACACCAGAGCCCTTCCCAGCGACCTCCAAAGAGCGGCCACGCTCTTTAGTGGACA
GCAAGGCCTATGCGGATGCCAGGGTTTTGGTGGCCAAGTTTTTGGAACACTCACACTGTGCCCTCCCCACCGAGGCACAGCACATGGTGG
GTGCCATGCGCTTGGCTGTCACCAACGAGGAGCGCCTCGAGGAGGAGGCCGTCTTCGGCGCTGACGTTCTGGACCAGGTATGAAGGAGCC
ACATTTCTGACCGTGGACACCAACGCCTGGCGCCACAGATGTTCTTGGCAGAAGCCATCATGCCTGACAAAGAGGCCTTCAGGCCCAGCT
TGGCGGAGGATAAATGTGGGGGGGACACCCAGGATGATCTGGGGGCGGTGTGGGCAGGGAACTGTTACCCCCTCTCTCGAGGGGAGCCGA
GCAGTGTCTCTTTGGGGATTGCATTTCCTGCCTAGCCCAGTAATTCGGAAAGATGACTTTCACGTCCACAGTGAACTCTCTGGTTTTATC
TGGCGTGCAGCACCTTGAACTGAGCAGTGTTGCACAAATGTGAATACAGCAACAGGCGACACTTACGTCACCTAAAGACTCAAAGTATCT
CCAAAATCAGGGCCTTCCAAAGCAGGAGTCTCCCATCCCCCATTTAACTTAGTGTTCAGTGGACAGAGGGTGACATCGAGTCATGAAACA
TTTTCTCATGTGGCTCGATGGCTCTATCATTAGGCGTTCATCACGCTCTGGCCTATTTCCTGTGAAAGGAAATAGGTAGTGTTAGCACAG
ATGGCAGCCTGGGCCCAACTTTCTGTCCACAGGGCTATTGTGCAAACAAATGTGCAGTGCGGGCCTCTGCCATAGCCCGGCCCCCCCCAG
GGAACAGGCCGGTGTTGCGGGGGTTGGAGGAACCCACCATCTCCTGGGCCTTGAGCTCGGCCTCCCTCCGTGGGGTGCCTTCCCCCCCTC
CTCTTGGGCCCCCTTTCTCCAGGCTCCCATCCTGTCCCTGGAGCAGTTGTGTGATCCGTAACAACAAGTGCCGATTCCCAGCTCCTTTGT
GTCTGAGCTCACTTGATTGAGCTCAGCGGGTCACAGTTCTGCAGGAGAGAGGCCGGTTTCTCTGAGAAGTAGCCCCTCCTGATAAAGCAG
GTCCCTTTGACCCAGAGCTGACCTTTCCCCGGGCATGCGGCAGCAGACACACCTGCGCAGGAGGATCATAAACCACTTACAAACCCACAC
GAGAAGGGAAGCAGACACCCAACGTGCTGCTTATGGAGAAGCAGACACGCCCAGCTTGGGGACAGCCTGGGGACCTTGGACTTTCTTAGC
CCCCATCCCCTTGTTTTCTGGTGGCATCAGTGGCAGCTGCTCCCAACAATGGCCGTGGAACAGCGCCATCCACGAGAACTTTGTGCAGTG
ATGGAAATGCCTGTTCAGGGCCACTAGCAGCCACAGCCCCTGAGCTGCGTTGGGTGGGCCCTGCGGTGAACAAAACAGCCTAGAGGCCAA
GGTCTCCCCAGAGAGCCCATGAGCCTGGCATGGGGGCGCAGGGGGACCAGAGGGTGTCTTCCACTCCTGGGTGCCAGGGCAGGGGGCTCA
CGCTGCTGTTCCCTCGGCTTTGTGGGGCTTGTCCTTGAGCTCCCCCAATTCCCTAATGCCACTGTGGCCAGTGTGCTGGGGAGCTTCTGT
GTGGCTGGAAGCTGGGAAGGGGGTGAGGTTCCAATCCAGGTGCCCAGAGCCTTCCTCCAGTCCTTTATCCCTGCCCTGGGGGCTGCGGTG
TGGGACTCCTTCAGCTGTGGTCGGCTGAAAAGGCTTCGATTGCTTTAGAGAGCTGAAAACACATAAGCCAGGCCTTTTGATGACAACCTG
CACTTTTGCAGGAGAGACGTACTAGAGATGAATTTTTGAGCACTTTATTCAGACTATAAAACAGGAAATCTCTAATTTTCCTCAAGTGGG
GGCTTTTGAATTCCCTCAAGGCAAGTCCCTTTGCAGGTGAAATTAATTGGTGGATTTTCAGAATGGCCGCCCTGGAGCCGAGCTTCAGCC
ACGCCTGACGCCCTGGCCTCTGAATCTCCACTGTCTCTGAGGTGCGCTGGGGCCACGCCGCAGGGGTTTCACCTGCTTGGGGGGGTCCAC
ACTAGGGCTTGGGGGTTCACACAGCATTGTCCCTGGGCTGAGCCCTTGGGTGGGCTAGAGCTGCAGTCCTCAGACATGGCTGCAATTCCA
GCGAGGCCAAGACCACCAGCCACCCAGTGGACTCGGTCTCTGGGGTGTTCTCCTCATGCAGCCGGGGCAGAGGCCTACTGGACCCCCTCA
GCCTGCTGCTCAGCATCCTTCCCTTCTCTGCAGCAGGGCCCGGTCCCAATGGCCAATGGGGCTGCTGCCCCAGCAGTGCCTCCCTGTAGG
CCCCTCACCTGCACCCCACCTTCACCCAGCTCTGGGTTTGCGCTGGTGGCAGCTCTGTTTTGTGGATACGGAAACTGTACCCAACTTGAT
GCCGCTGGGCTGGAACCTTCTGCCCCTTCGAAATGAGGCAGTCAGGGACGGGGTGGGGTGCCCCCATCAGCCCCGCTGCTCAGGGCCACT
CATGGACTCTAGGAGGGTCCAGGTTCTGGGCTTCCTGGGAAGGTCCCCAGAAGAGAGAGGTGCTGGTAGACTAGGGAATGTGCTGGCAAC
TTGACCCAGAAGCTGTGGTCCCCTTGGCCCCGGCTCCACGGCATCCGGGTACCAGCAGCAAGAGCCCAGGCCCCGGGCTGCACGTCAGCT
CACAGCCCAGGAGAAAGCTGGCTGCTTCCCCTCCCTATGCGTCTTTCCCCCGCTCCAATCATGTTCCATCTGGGATCTGAAATGGGCCAA
CTGTGGCTGCTTTGGGGGTGACACGCTCCTTCTCCAACTCAGCTGGGCCCCGGGCATCCCCTGCCCTCCCCTGAGACCCAAAGGGGGTTG
GCACCTGCTGTGACACCACCGTTGACCCCAGCCTGGGGGCCACAAGGTTGCTGAGTGGGGAGAACATGGACCCCAACTCTATGGCAAGCA
AGATCGCAGAAGGGGGAGCATCATCCGCAAGGACTTCAGGTCTCCCTTGGCTGGAGATGAGGATCCACATTAAATGCTTGTAACACACCA
GGCCACAGAAAGCTCGCTACACACACATGCTTCTCCCCACCCATGCTGACTCTCAGAGGCTGCTAAGGCAGAATTTATAGGAAATTGTTT
TCAAGCCACCAGAGACCTGTCTGTACAACTGGAAAGGCTGTATTTATTTAATGTACCTCAAGGTGTTTTAATAATGATCCGTGTTTTAAT

>In-frame_CYFIP1_ENST00000560848_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_8274nt
AGTGACTCACTCGGCCAAGGAAACTCCCAGGGCCCGCCCAGGACCCCCAAGCCGCCGCGGACGCAGAATGTGGCTCAGCTGCCCCTGGTC
CCATCCCAGGGCAGAGCTCCTCCTGAGTACCCTTGAGACTGGAGCAGATTCAGCAGAAGGCAGATTGCCCCCTCTCCCTGGAGCTGGCTC
TGAAGCCCAGGATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGGAGCTGCCCCTGCCCGACCAGCAGC
CCTGCATCGAGCCCCCGCCATCCTCGCTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTTACTGGCATCG
CAAGATACATTGAACAAGCCACCGTCCACTCTAGCATGAACGAGATGCTGGAGGAGGGCCAAGAATATGCTGTCATGCTGTACACCTGGA
GGAGCTGCTCCCGGGCCATCCCACAGGTGAAATGTAACGAGCAGCCTAACAGAGTGGAAATCTACGAGAAAACCGTGGAGGTTCTGGAGC
CTGAGGTCACAAAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTGAGCGTTTCTGCGGGGAAGTGAGGCGCCTGTGCCATGCCG
AGAGGAGGAAGGACTTCGTGTCAGAAGCCTACCTGATCACACTGGGCAAATTCATCAACATGTTCGCTGTGCTGGACGAGCTGAAGAACA
TGAAGTGCAGTGTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGGCAGATCCACAGTCCATCCAGGAAT
CGCAGAATCTGTCCATGTTCCTGGCCAATCATAACAAGATCACACAGTCTCTGCAGCAGCAGCTCGAAGTGATTTCTGGCTACGAAGAGC
TCCTGGCAGATATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCA
TGGGATTTGGTCTGTACCTGATGGATGGGAGTGTCAGTAACATCTATAAGTTGGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACA
AGTACTTCAAGCAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATATCAAGACCAGCGCCCACTACGAGG
AAAATAAATCTCGATGGACGTGCACATCCTCCGGCAGCAGCCCTCAGTACAACATCTGCGAGCAGATGATCCAGATCCGCGAGGACCACA
TGCGCTTCATTTCGGAGCTGGCGCGCTACAGCAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGGAGGCCCAGAAGACGGACGCGGAGT
ACCGCAAGCTCTTCGACCTGGCGCTGCAGGGCCTGCAGCTGTTGTCGCAGTGGAGCGCGCACGTGATGGAAGTGTATTCCTGGAAGCTTG
TGCACCCCACCGACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAGAGTACGAGCGTGCCACGCGCTACAACTACACCAGCGAGG
AGAAGTTTGCCCTAGTGGAGGTGATCGCCATGATCAAAGGCCTGCAGGTGCTGATGGGCAGGATGGAGAGCGTGTTCAACCACGCCATCC
GGCACACCGTCTATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGGCCATCAAGAAGAAGAAGAACGTCA
TCCAGAGTGTCCTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACGGGGCATGAGCCCTTCAATGACCCAGCCTTGCGGGGCGAGA
AGGACCCCAAGAGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGCTTTACATGGTGAGAACCATGCTAG
AGTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATC
GAGAGTCATTCTTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCT
TCCTGGAGCTGACCATGGGCAGGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGG
AGGCATCGATGATGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCC
TGTACGACGAAATTGAGGCCGAGGTGAATCTATGTTTTGACCAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTA
TGGCAGGAAGTTTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACG
AGACGCTGCTGAAGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGT
ATAAGTCCCTAGAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGCCTGTTGGAAATCAACCGCA
TGACCCACAAGCTGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACG
GGAGGATCACCCTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGA
CAGTGTTACCATTTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGG
CCTACTCCAGCATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCG
CCGTGGTCATGGAGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGC
CCAAGATCTGCCGCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACG
CAGAGCTGAAGACGGTGTGCTTCCAGAACCTGCGGGAGGTGGGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAG
AAGAAGTGTGTGACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAA
TGAAAAGACTAGAATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAG
AGGGGGACCTGCTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATCCGGAGCTTTCTGGATGACC
CCATCTGGCGCGGGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTG
TCTACTGCATTCCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTAC
TTCTTGGGCAGCAGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTA
AAAATGTGGTGCTGCTGTCGGGACTCATAGGTGTCGTCTCCTGGAAGAGGCCTCTCTCCCTTGTGATAACCTTTTTCATGCTGCTTTCTG
CAGTGTGTGTAATGCTGAATTTGGCTGGTTCAATTCTCTCTTGTCAGAATGCTCAGCTAGTCAACTCCCTAGAAGGCTGCCAGTTGATTA
AGTTTGACAGTGTGGAGGTGTGTGTCTGCTGTGAGCTGCAGCACCAGTCGTCCGGCTGCAGCAACCTCGGGGAGACGCTGAAGCTGAACC
CGCTGCAGGAGAACTGCAACGCTGTGAGGCTGACCTTGAAGGATCTCCTCTTCAGCGTGTGTGCCCTCAACGTCCTGTCCACTATCGTGT
GTGCGCTGGCCACAGCCATGTGCTGTATGCAGATGGTCTCCTCCGATGTCCTGCAGATGTTCCTTCCGCAGAGGTCACATCCTGCCAACC
CCACCTGCGTGACTCCTCACGGCACCGTTCTCCACCAGACCCTGGATTTCGACGAGTTCATCCCCCCACTCCCGCCTCCACCCTATTACC
CCCCAGAGTACACCTGCACACCGTCCACTGAGGCCCAGAGGGGCCTCCACCTGGACTTTGCTCCGTCTCCATTCGGCACTTTGTATGACG
TGGCCATCAATAGCCCCGGCCTGCTCTATCCTGCTGAGCTCCCCCCTCCGTACGAGGCGGTGGTGGGCCAGCCCCCTGCCAGCCAGGTTA
CAAGTATAGGTCAGCAGGTGGCCGAGTCCAGCTCCGGGGACCCAAACACCAGTGCTGGCTTCAGCACTCCAGTACCAGCTGACAGCACAA
GCCTCCTGGTGTCCGAGGGCACTGCTACGCCAGGTTCCAGCCCATCCCCCGATGGCCCTGTGGGCGCCCCAGCACCCTCCGAACCTGCCC
TTCCCCCTGGCCATGTGTCTCCAGAGGATCCTGGCATGGGCTCACAGGTGCAGCCAGGTCCCGGGCGTGTGTCCCGCTCCACCAGCGACC
CCACCTTGTGCACATCTAGCATGGCAGGCGATGCCTCTTCACACAGGCCGTCGTGTAGCCAGGACCTGGAAGCGGGACTGTCTGAGGCTG
TGCCTGGGAGCGCTTCCATGTCTCGCTCTGCCACGGCTGCCTGTCGGGCCCAGCTTTCACCAGCGGGGGACCCAGATACCTGGAAAACTG
ACCAACGGCCAACACCAGAGCCCTTCCCAGCGACCTCCAAAGAGCGGCCACGCTCTTTAGTGGACAGCAAGGCCTATGCGGATGCCAGGG
TTTTGGTGGCCAAGTTTTTGGAACACTCACACTGTGCCCTCCCCACCGAGGCACAGCACATGGTGGGTGCCATGCGCTTGGCTGTCACCA
ACGAGGAGCGCCTCGAGGAGGAGGCCGTCTTCGGCGCTGACGTTCTGGACCAGGTATGAAGGAGCCACATTTCTGACCGTGGACACCAAC
GCCTGGCGCCACAGATGTTCTTGGCAGAAGCCATCATGCCTGACAAAGAGGCCTTCAGGCCCAGCTTGGCGGAGGATAAATGTGGGGGGG
ACACCCAGGATGATCTGGGGGCGGTGTGGGCAGGGAACTGTTACCCCCTCTCTCGAGGGGAGCCGAGCAGTGTCTCTTTGGGGATTGCAT
TTCCTGCCTAGCCCAGTAATTCGGAAAGATGACTTTCACGTCCACAGTGAACTCTCTGGTTTTATCTGGCGTGCAGCACCTTGAACTGAG
CAGTGTTGCACAAATGTGAATACAGCAACAGGCGACACTTACGTCACCTAAAGACTCAAAGTATCTCCAAAATCAGGGCCTTCCAAAGCA
GGAGTCTCCCATCCCCCATTTAACTTAGTGTTCAGTGGACAGAGGGTGACATCGAGTCATGAAACATTTTCTCATGTGGCTCGATGGCTC
TATCATTAGGCGTTCATCACGCTCTGGCCTATTTCCTGTGAAAGGAAATAGGTAGTGTTAGCACAGATGGCAGCCTGGGCCCAACTTTCT
GTCCACAGGGCTATTGTGCAAACAAATGTGCAGTGCGGGCCTCTGCCATAGCCCGGCCCCCCCCAGGGAACAGGCCGGTGTTGCGGGGGT
TGGAGGAACCCACCATCTCCTGGGCCTTGAGCTCGGCCTCCCTCCGTGGGGTGCCTTCCCCCCCTCCTCTTGGGCCCCCTTTCTCCAGGC
TCCCATCCTGTCCCTGGAGCAGTTGTGTGATCCGTAACAACAAGTGCCGATTCCCAGCTCCTTTGTGTCTGAGCTCACTTGATTGAGCTC
AGCGGGTCACAGTTCTGCAGGAGAGAGGCCGGTTTCTCTGAGAAGTAGCCCCTCCTGATAAAGCAGGTCCCTTTGACCCAGAGCTGACCT
TTCCCCGGGCATGCGGCAGCAGACACACCTGCGCAGGAGGATCATAAACCACTTACAAACCCACACGAGAAGGGAAGCAGACACCCAACG
TGCTGCTTATGGAGAAGCAGACACGCCCAGCTTGGGGACAGCCTGGGGACCTTGGACTTTCTTAGCCCCCATCCCCTTGTTTTCTGGTGG
CATCAGTGGCAGCTGCTCCCAACAATGGCCGTGGAACAGCGCCATCCACGAGAACTTTGTGCAGTGATGGAAATGCCTGTTCAGGGCCAC
TAGCAGCCACAGCCCCTGAGCTGCGTTGGGTGGGCCCTGCGGTGAACAAAACAGCCTAGAGGCCAAGGTCTCCCCAGAGAGCCCATGAGC
CTGGCATGGGGGCGCAGGGGGACCAGAGGGTGTCTTCCACTCCTGGGTGCCAGGGCAGGGGGCTCACGCTGCTGTTCCCTCGGCTTTGTG
GGGCTTGTCCTTGAGCTCCCCCAATTCCCTAATGCCACTGTGGCCAGTGTGCTGGGGAGCTTCTGTGTGGCTGGAAGCTGGGAAGGGGGT
GAGGTTCCAATCCAGGTGCCCAGAGCCTTCCTCCAGTCCTTTATCCCTGCCCTGGGGGCTGCGGTGTGGGACTCCTTCAGCTGTGGTCGG
CTGAAAAGGCTTCGATTGCTTTAGAGAGCTGAAAACACATAAGCCAGGCCTTTTGATGACAACCTGCACTTTTGCAGGAGAGACGTACTA
GAGATGAATTTTTGAGCACTTTATTCAGACTATAAAACAGGAAATCTCTAATTTTCCTCAAGTGGGGGCTTTTGAATTCCCTCAAGGCAA
GTCCCTTTGCAGGTGAAATTAATTGGTGGATTTTCAGAATGGCCGCCCTGGAGCCGAGCTTCAGCCACGCCTGACGCCCTGGCCTCTGAA
TCTCCACTGTCTCTGAGGTGCGCTGGGGCCACGCCGCAGGGGTTTCACCTGCTTGGGGGGGTCCACACTAGGGCTTGGGGGTTCACACAG
CATTGTCCCTGGGCTGAGCCCTTGGGTGGGCTAGAGCTGCAGTCCTCAGACATGGCTGCAATTCCAGCGAGGCCAAGACCACCAGCCACC
CAGTGGACTCGGTCTCTGGGGTGTTCTCCTCATGCAGCCGGGGCAGAGGCCTACTGGACCCCCTCAGCCTGCTGCTCAGCATCCTTCCCT
TCTCTGCAGCAGGGCCCGGTCCCAATGGCCAATGGGGCTGCTGCCCCAGCAGTGCCTCCCTGTAGGCCCCTCACCTGCACCCCACCTTCA
CCCAGCTCTGGGTTTGCGCTGGTGGCAGCTCTGTTTTGTGGATACGGAAACTGTACCCAACTTGATGCCGCTGGGCTGGAACCTTCTGCC
CCTTCGAAATGAGGCAGTCAGGGACGGGGTGGGGTGCCCCCATCAGCCCCGCTGCTCAGGGCCACTCATGGACTCTAGGAGGGTCCAGGT
TCTGGGCTTCCTGGGAAGGTCCCCAGAAGAGAGAGGTGCTGGTAGACTAGGGAATGTGCTGGCAACTTGACCCAGAAGCTGTGGTCCCCT
TGGCCCCGGCTCCACGGCATCCGGGTACCAGCAGCAAGAGCCCAGGCCCCGGGCTGCACGTCAGCTCACAGCCCAGGAGAAAGCTGGCTG
CTTCCCCTCCCTATGCGTCTTTCCCCCGCTCCAATCATGTTCCATCTGGGATCTGAAATGGGCCAACTGTGGCTGCTTTGGGGGTGACAC
GCTCCTTCTCCAACTCAGCTGGGCCCCGGGCATCCCCTGCCCTCCCCTGAGACCCAAAGGGGGTTGGCACCTGCTGTGACACCACCGTTG
ACCCCAGCCTGGGGGCCACAAGGTTGCTGAGTGGGGAGAACATGGACCCCAACTCTATGGCAAGCAAGATCGCAGAAGGGGGAGCATCAT
CCGCAAGGACTTCAGGTCTCCCTTGGCTGGAGATGAGGATCCACATTAAATGCTTGTAACACACCAGGCCACAGAAAGCTCGCTACACAC
ACATGCTTCTCCCCACCCATGCTGACTCTCAGAGGCTGCTAAGGCAGAATTTATAGGAAATTGTTTTCAAGCCACCAGAGACCTGTCTGT

>In-frame_CYFIP1_ENST00000435939_chr15_23000243_-_FAM189A1_ENST00000261275_chr15_29674035_-_7092nt
CCGGTTTAATCCACACCGCTGCGTCTGTCCTCCGTCCTGGGGCTGGTCTTCTCCCTCATCTCTGCCGGAGGCTTTTAATCTCTTCTGCCA
CTCTTCTGGAAAGTCACCAGCAATGCACGCTGCTGGCTCTGCAGGAGGGTCAGGGGGACGGCCCTCGGCCTGTGCGTGGTGCCAGCCACC
CTCCCTGCCTCCCTCTGCGTGCGTCCCGTGTCCCTGCCTGGGGTGTGTGTGTCGAGTGACTAACGTCTCTCTCCTGCCTCTCCCTCCTGT
CTGTCCGTGTCTAGCTCTACCTGGTGCGCACCATGGCCGAGTCCTTGGGCTCTGCCGAGCTGCTCAGGCAGCTCAAGTCTCTGGGCATGG
AGAGGCTCTTGCATGCGGTTAACACGTTTCTGAGGCAGTCGTGCACCTACCTACCCCTTTTAACCTTTGGTGGTAAGACATCATTTGTTT
CTCTTGACGTTTATGGCACGGAGGCGAACTGCTCCGCTACAAGTTGTTCTTTCCCCAAAGCAGCAGCAACGTGGCCGCGTAGACAGGCAC
CCGGACCCCTCGGGGAGCTGGTGCGGGGCCCTCCCGACCAGGGCGTAGCGGAGCAGTCCTTCTCTCATGGGCTTTTTGAGTTTGGCATAA
CTAATGTACCATGTATATTTTCTCCCCCACAAATGTTTCCTTGGATAATCCAGCTTTACATGGTGAGAACCATGCTAGAGTCCCTCATTG
CAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTCT
TCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTGA
CCATGGGCAGGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATGA
TGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCCTGTACGACGAAA
TTGAGGCCGAGGTGAATCTATGTTTTGACCAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGTT
TGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTGA
AGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTAG
AACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGCCTGTTGGAAATCAACCGCATGACCCACAAGC
TGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACGGGAGGATCACCC
TGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGACAGTGTTACCAT
TTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGCA
TTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATGG
AGGAGCTGCTGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGCC
GCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAGA
CGGTGTGCTTCCAGAACCTGCGGGAGGTGGGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGTG
ACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAATGAAAAGACTAG
AATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTGC
TGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATCCGGAGCTTTCTGGATGACCCCATCTGGCGCG
GGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTGTCTACTGCATTC
CCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTACTTCTTGGGCAGC
AGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGGTGC
TGCTGTCGGGACTCATAGGTGTCGTCTCCTGGAAGAGGCCTCTCTCCCTTGTGATAACCTTTTTCATGCTGCTTTCTGCAGTGTGTGTAA
TGCTGAATTTGGCTGGTTCAATTCTCTCTTGTCAGAATGCTCAGCTAGTCAACTCCCTAGAAGGCTGCCAGTTGATTAAGTTTGACAGTG
TGGAGGTGTGTGTCTGCTGTGAGCTGCAGCACCAGTCGTCCGGCTGCAGCAACCTCGGGGAGACGCTGAAGCTGAACCCGCTGCAGGAGA
ACTGCAACGCTGTGAGGCTGACCTTGAAGGATCTCCTCTTCAGCGTGTGTGCCCTCAACGTCCTGTCCACTATCGTGTGTGCGCTGGCCA
CAGCCATGTGCTGTATGCAGATGGTCTCCTCCGATGTCCTGCAGATGTTCCTTCCGCAGAGGTCACATCCTGCCAACCCCACCTGCGTGA
CTCCTCACGGCACCGTTCTCCACCAGACCCTGGATTTCGACGAGTTCATCCCCCCACTCCCGCCTCCACCCTATTACCCCCCAGAGTACA
CCTGCACACCGTCCACTGAGGCCCAGAGGGGCCTCCACCTGGACTTTGCTCCGTCTCCATTCGGCACTTTGTATGACGTGGCCATCAATA
GCCCCGGCCTGCTCTATCCTGCTGAGCTCCCCCCTCCGTACGAGGCGGTGGTGGGCCAGCCCCCTGCCAGCCAGGTTACAAGTATAGGTC
AGCAGGTGGCCGAGTCCAGCTCCGGGGACCCAAACACCAGTGCTGGCTTCAGCACTCCAGTACCAGCTGACAGCACAAGCCTCCTGGTGT
CCGAGGGCACTGCTACGCCAGGTTCCAGCCCATCCCCCGATGGCCCTGTGGGCGCCCCAGCACCCTCCGAACCTGCCCTTCCCCCTGGCC
ATGTGTCTCCAGAGGATCCTGGCATGGGCTCACAGGTGCAGCCAGGTCCCGGGCGTGTGTCCCGCTCCACCAGCGACCCCACCTTGTGCA
CATCTAGCATGGCAGGCGATGCCTCTTCACACAGGCCGTCGTGTAGCCAGGACCTGGAAGCGGGACTGTCTGAGGCTGTGCCTGGGAGCG
CTTCCATGTCTCGCTCTGCCACGGCTGCCTGTCGGGCCCAGCTTTCACCAGCGGGGGACCCAGATACCTGGAAAACTGACCAACGGCCAA
CACCAGAGCCCTTCCCAGCGACCTCCAAAGAGCGGCCACGCTCTTTAGTGGACAGCAAGGCCTATGCGGATGCCAGGGTTTTGGTGGCCA
AGTTTTTGGAACACTCACACTGTGCCCTCCCCACCGAGGCACAGCACATGGTGGGTGCCATGCGCTTGGCTGTCACCAACGAGGAGCGCC
TCGAGGAGGAGGCCGTCTTCGGCGCTGACGTTCTGGACCAGGTATGAAGGAGCCACATTTCTGACCGTGGACACCAACGCCTGGCGCCAC
AGATGTTCTTGGCAGAAGCCATCATGCCTGACAAAGAGGCCTTCAGGCCCAGCTTGGCGGAGGATAAATGTGGGGGGGACACCCAGGATG
ATCTGGGGGCGGTGTGGGCAGGGAACTGTTACCCCCTCTCTCGAGGGGAGCCGAGCAGTGTCTCTTTGGGGATTGCATTTCCTGCCTAGC
CCAGTAATTCGGAAAGATGACTTTCACGTCCACAGTGAACTCTCTGGTTTTATCTGGCGTGCAGCACCTTGAACTGAGCAGTGTTGCACA
AATGTGAATACAGCAACAGGCGACACTTACGTCACCTAAAGACTCAAAGTATCTCCAAAATCAGGGCCTTCCAAAGCAGGAGTCTCCCAT
CCCCCATTTAACTTAGTGTTCAGTGGACAGAGGGTGACATCGAGTCATGAAACATTTTCTCATGTGGCTCGATGGCTCTATCATTAGGCG
TTCATCACGCTCTGGCCTATTTCCTGTGAAAGGAAATAGGTAGTGTTAGCACAGATGGCAGCCTGGGCCCAACTTTCTGTCCACAGGGCT
ATTGTGCAAACAAATGTGCAGTGCGGGCCTCTGCCATAGCCCGGCCCCCCCCAGGGAACAGGCCGGTGTTGCGGGGGTTGGAGGAACCCA
CCATCTCCTGGGCCTTGAGCTCGGCCTCCCTCCGTGGGGTGCCTTCCCCCCCTCCTCTTGGGCCCCCTTTCTCCAGGCTCCCATCCTGTC
CCTGGAGCAGTTGTGTGATCCGTAACAACAAGTGCCGATTCCCAGCTCCTTTGTGTCTGAGCTCACTTGATTGAGCTCAGCGGGTCACAG
TTCTGCAGGAGAGAGGCCGGTTTCTCTGAGAAGTAGCCCCTCCTGATAAAGCAGGTCCCTTTGACCCAGAGCTGACCTTTCCCCGGGCAT
GCGGCAGCAGACACACCTGCGCAGGAGGATCATAAACCACTTACAAACCCACACGAGAAGGGAAGCAGACACCCAACGTGCTGCTTATGG
AGAAGCAGACACGCCCAGCTTGGGGACAGCCTGGGGACCTTGGACTTTCTTAGCCCCCATCCCCTTGTTTTCTGGTGGCATCAGTGGCAG
CTGCTCCCAACAATGGCCGTGGAACAGCGCCATCCACGAGAACTTTGTGCAGTGATGGAAATGCCTGTTCAGGGCCACTAGCAGCCACAG
CCCCTGAGCTGCGTTGGGTGGGCCCTGCGGTGAACAAAACAGCCTAGAGGCCAAGGTCTCCCCAGAGAGCCCATGAGCCTGGCATGGGGG
CGCAGGGGGACCAGAGGGTGTCTTCCACTCCTGGGTGCCAGGGCAGGGGGCTCACGCTGCTGTTCCCTCGGCTTTGTGGGGCTTGTCCTT
GAGCTCCCCCAATTCCCTAATGCCACTGTGGCCAGTGTGCTGGGGAGCTTCTGTGTGGCTGGAAGCTGGGAAGGGGGTGAGGTTCCAATC
CAGGTGCCCAGAGCCTTCCTCCAGTCCTTTATCCCTGCCCTGGGGGCTGCGGTGTGGGACTCCTTCAGCTGTGGTCGGCTGAAAAGGCTT
CGATTGCTTTAGAGAGCTGAAAACACATAAGCCAGGCCTTTTGATGACAACCTGCACTTTTGCAGGAGAGACGTACTAGAGATGAATTTT
TGAGCACTTTATTCAGACTATAAAACAGGAAATCTCTAATTTTCCTCAAGTGGGGGCTTTTGAATTCCCTCAAGGCAAGTCCCTTTGCAG
GTGAAATTAATTGGTGGATTTTCAGAATGGCCGCCCTGGAGCCGAGCTTCAGCCACGCCTGACGCCCTGGCCTCTGAATCTCCACTGTCT
CTGAGGTGCGCTGGGGCCACGCCGCAGGGGTTTCACCTGCTTGGGGGGGTCCACACTAGGGCTTGGGGGTTCACACAGCATTGTCCCTGG
GCTGAGCCCTTGGGTGGGCTAGAGCTGCAGTCCTCAGACATGGCTGCAATTCCAGCGAGGCCAAGACCACCAGCCACCCAGTGGACTCGG
TCTCTGGGGTGTTCTCCTCATGCAGCCGGGGCAGAGGCCTACTGGACCCCCTCAGCCTGCTGCTCAGCATCCTTCCCTTCTCTGCAGCAG
GGCCCGGTCCCAATGGCCAATGGGGCTGCTGCCCCAGCAGTGCCTCCCTGTAGGCCCCTCACCTGCACCCCACCTTCACCCAGCTCTGGG
TTTGCGCTGGTGGCAGCTCTGTTTTGTGGATACGGAAACTGTACCCAACTTGATGCCGCTGGGCTGGAACCTTCTGCCCCTTCGAAATGA
GGCAGTCAGGGACGGGGTGGGGTGCCCCCATCAGCCCCGCTGCTCAGGGCCACTCATGGACTCTAGGAGGGTCCAGGTTCTGGGCTTCCT
GGGAAGGTCCCCAGAAGAGAGAGGTGCTGGTAGACTAGGGAATGTGCTGGCAACTTGACCCAGAAGCTGTGGTCCCCTTGGCCCCGGCTC
CACGGCATCCGGGTACCAGCAGCAAGAGCCCAGGCCCCGGGCTGCACGTCAGCTCACAGCCCAGGAGAAAGCTGGCTGCTTCCCCTCCCT
ATGCGTCTTTCCCCCGCTCCAATCATGTTCCATCTGGGATCTGAAATGGGCCAACTGTGGCTGCTTTGGGGGTGACACGCTCCTTCTCCA
ACTCAGCTGGGCCCCGGGCATCCCCTGCCCTCCCCTGAGACCCAAAGGGGGTTGGCACCTGCTGTGACACCACCGTTGACCCCAGCCTGG
GGGCCACAAGGTTGCTGAGTGGGGAGAACATGGACCCCAACTCTATGGCAAGCAAGATCGCAGAAGGGGGAGCATCATCCGCAAGGACTT
CAGGTCTCCCTTGGCTGGAGATGAGGATCCACATTAAATGCTTGTAACACACCAGGCCACAGAAAGCTCGCTACACACACATGCTTCTCC
CCACCCATGCTGACTCTCAGAGGCTGCTAAGGCAGAATTTATAGGAAATTGTTTTCAAGCCACCAGAGACCTGTCTGTACAACTGGAAAG


Top

FusionGenePPI for CYFIP1_FAM189A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CYFIP1FMR1, FXR1, FXR2, NCL, TERF1, TERF2, RYK, MARK4, YWHAH, YWHAZ, PPP1CC, RFX6, GNB1, SCTR, EFTUD2, HECW2, TCERG1, PRPF40A, APBB1, GAS7, ARHGEF1, CLUH, NCKAP1, WWOX, EFHC2, MEOX1, ZNF511, UBXN11, DTNBP1, NCK2, LHX4, BAIAP2, BZW2, ABI1, ACTR1B, CHURC1-FNTB, DCTN1, NCKAP1L, FNBP1L, TRIP10, WASF1, WASF2, NTRK1, TMEM17, PCNA, LIMA1, ARX, ZNF746, ABI2, TIMM50, AMZ1, IKBIP, WASF3, CGB2, CBLC, NHSL2, NYAP1, NYAP2, MYO16, CDH23, TRIM25, YAP1FAM189A1CLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CYFIP1_FAM189A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CYFIP1_FAM189A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCYFIP1C0036341Schizophrenia1PSYGENET