FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9049

FusionGeneSummary for CWH43_OCIAD1

check button Fusion gene summary
Fusion gene informationFusion gene name: CWH43_OCIAD1
Fusion gene ID: 9049
HgeneTgene
Gene symbol

CWH43

OCIAD1

Gene ID

80157

54940

Gene namecell wall biogenesis 43 C-terminal homologOCIA domain containing 1
SynonymsCWH43-C|PGAP2IPASRIJ|OCIA|TPA018
Cytomap

4p11

4p11

Type of geneprotein-codingprotein-coding
DescriptionPGAP2-interacting proteincell wall biogenesis protein 43 C-terminal homologOCIA domain-containing protein 1ovarian cancer immunoreactive antigen domain containing 1ovarian cancer immunoreactive antigen domain containing 1Aovarian carcinoma immunoreactive antigen
Modification date2018052320180519
UniProtAcc

Q9H720

Q9NX40

Ensembl transtripts involved in fusion geneENST00000226432, ENST00000513409, 
ENST00000509122, ENST00000512981, 
ENST00000396448, ENST00000264312, 
ENST00000381473, ENST00000444354, 
ENST00000506801, ENST00000425583, 
ENST00000508293, ENST00000513391, 
Fusion gene scores* DoF score1 X 1 X 1=11 X 1 X 1=1
# samples 11
** MAII scorelog2(1/1*10)=3.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: CWH43 [Title/Abstract] AND OCIAD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-AX-A3FW-01ACWH43chr4

49052866

+OCIAD1chr4

48862742

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000226432ENST00000509122CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-intronENST00000226432ENST00000512981CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000396448CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000264312CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000381473CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000444354CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000506801CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000425583CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000508293CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000226432ENST00000513391CWH43chr4

49052866

+OCIAD1chr4

48862742

+
In-frameENST00000513409ENST00000509122CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-intronENST00000513409ENST00000512981CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000396448CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000264312CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000381473CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000444354CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000506801CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000425583CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000508293CWH43chr4

49052866

+OCIAD1chr4

48862742

+
5CDS-3UTRENST00000513409ENST00000513391CWH43chr4

49052866

+OCIAD1chr4

48862742

+

Top

FusionProtFeatures for CWH43_OCIAD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CWH43

Q9H720

OCIAD1

Q9NX40

Involved in lipid remodeling during GPI-anchormaturation. {ECO:0000250}. Maintains stem cell potency (By similarity). IncreasesSTAT3 phosphorylation and controls ERK phosphorylation (Bysimilarity). May act as a scaffold, increasing STAT3 recruitmentonto endosomes (By similarity). Involved in integrin-mediatedcancer cell adhesion and colony formation in ovarian cancer(PubMed:20515946). {ECO:0000250|UniProtKB:Q9CRD0,ECO:0000269|PubMed:20515946}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516607_627673700RegionRequired for function in lipid remodeling
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516123_143673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+151613_33673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516196_216673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516237_257673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516273_293673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516316_336673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516349_369673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+1516390_410673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+151641_61673700TransmembraneHelical
HgeneCWH43chr4:49052866chr4:48862742ENST00000226432+151693_113673700TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000264312+791_112233246DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000381473+791_112233246DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000396448+681_112197301DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000425583+681_112182195DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000444354+681_112182195DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000508293+791_112233246DomainNote=OCIA
TgeneOCIAD1chr4:49052866chr4:48862742ENST00000513391+791_112233246DomainNote=OCIA


Top

FusionGeneSequence for CWH43_OCIAD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CWH43_ENST00000226432_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_686aa
MPSLWREILLESLLGCVSWSLYHDLGPMIYYFPLQTLELTGLEGFSIAFLSPIFLTITPFWKLVNKKWMLTLLRIITIGSIASFQAPNAK
LRLMVLALGVSSSLIVQAVTWWSGSHLQRYLRIWGFILGQIVLVVLRIWYTSLNPIWSYQMSNKVILTLSAIATLDRIGTDGDCSKPEEK
KTGEVATGMASRPNWLLAGAAFGSLVFLTHWVFGEVSLVSRWAVSGHPHPGPDPNPFGGAVLLCLASGLMLPSCLWFRGTGLIWWVTGTA
SAAGLLYLHTWAAAVSGCVFAIFTASMWPQTLGHLINSGTNPGKTMTIAMIFYLLEIFFCAWCTAFKFVPGGVYARERSDVLLGTMMLII
GLNMLFGPKKNLDLLLQTKNSSKVLFRKSEKYMKLFLWLLVGVGLLGLGLRHKAYERKLGKVAPTKEVSAAIWPFRFGYDNEGWSSLERS
AHLLNETGADFITILESDASKPYMGNNDLTMWLGEKLGFYTDFGPSTRYHTWGIMALSRYPIVKSEHHLLPSPEGEIAPAITLTVNISGK
LVDFVVTHFGNHEDDLDRKLQAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISH

>In-frame_CWH43_ENST00000513409_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_659aa
MIYYFPLQTLELTGLEGFSIAFLSPIFLTITPFWKLVNKKWMLTLLRIITIGSIASFQAPNAKLRLMVLALGVSSSLIVQAVTWWSGSHL
QRYLRIWGFILGQIVLVVLRIWYTSLNPIWSYQMSNKVILTLSAIATLDRIGTDGDCSKPEEKKTGEVATGMASRPNWLLAGAAFGSLVF
LTHWVFGEVSLVSRWAVSGHPHPGPDPNPFGGAVLLCLASGLMLPSCLWFRGTGLIWWVTGTASAAGLLYLHTWAAAVSGCVFAIFTASM
WPQTLGHLINSGTNPGKTMTIAMIFYLLEIFFCAWCTAFKFVPGGVYARERSDVLLGTMMLIIGLNMLFGPKKNLDLLLQTKNSSKVLFR
KSEKYMKLFLWLLVGVGLLGLGLRHKAYERKLGKVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFITILESDASKPYMGNN
DLTMWLGEKLGFYTDFGPSTRYHTWGIMALSRYPIVKSEHHLLPSPEGEIAPAITLTVNISGKLVDFVVTHFGNHEDDLDRKLQAIAVSK
LLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CWH43_ENST00000226432_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_2059nt
ATGCCCTCGCTGTGGAGAGAAATCCTCTTGGAGTCGCTGCTGGGATGTGTTTCTTGGTCTCTCTACCATGACCTGGGACCGATGATCTAT
TACTTTCCTTTGCAAACACTAGAACTCACTGGGCTTGAAGGTTTTAGTATAGCATTTCTTTCTCCAATATTCCTAACAATTACTCCTTTC
TGGAAATTGGTTAACAAGAAGTGGATGCTAACCCTGCTGAGGATAATCACTATTGGCAGCATAGCCTCCTTCCAGGCTCCAAATGCCAAA
CTTCGACTGATGGTTCTTGCGCTTGGGGTGTCTTCCTCACTGATAGTGCAAGCTGTGACTTGGTGGTCAGGAAGTCATTTGCAAAGGTAC
CTCAGAATTTGGGGATTCATTTTAGGACAGATTGTTCTTGTTGTTCTACGCATATGGTATACTTCACTAAACCCAATCTGGAGTTATCAG
ATGTCCAACAAAGTGATACTGACATTAAGTGCCATAGCCACACTTGATCGTATTGGCACAGATGGTGACTGCAGTAAACCTGAAGAAAAG
AAGACTGGTGAGGTAGCCACGGGGATGGCCTCTAGACCCAACTGGCTGCTGGCAGGGGCTGCTTTTGGTAGCCTTGTGTTCCTCACCCAC
TGGGTTTTTGGAGAAGTCTCTCTTGTTTCCAGATGGGCAGTGAGTGGGCATCCACATCCAGGGCCAGATCCTAACCCATTTGGAGGTGCA
GTACTGCTGTGCTTGGCAAGTGGATTGATGCTTCCATCTTGTTTGTGGTTTCGTGGTACTGGTTTGATCTGGTGGGTTACAGGAACAGCT
TCAGCTGCGGGGCTCCTTTACCTGCACACATGGGCAGCTGCTGTGTCTGGCTGTGTCTTCGCCATCTTTACTGCATCCATGTGGCCCCAA
ACACTTGGACACCTTATTAACTCAGGGACAAACCCTGGGAAAACCATGACCATTGCCATGATATTTTATCTTCTAGAAATATTTTTCTGT
GCCTGGTGCACAGCTTTTAAGTTTGTCCCAGGAGGTGTCTACGCTAGAGAAAGATCAGATGTGCTTTTGGGGACAATGATGTTAATTATC
GGGCTGAATATGCTATTTGGTCCTAAGAAAAACCTTGACTTGCTTCTTCAAACAAAAAACAGTTCTAAAGTGCTTTTCAGAAAGAGTGAA
AAATACATGAAACTTTTTCTGTGGCTGCTTGTTGGTGTGGGATTGTTGGGATTAGGACTACGGCATAAAGCCTATGAGAGAAAACTGGGC
AAAGTGGCACCAACCAAAGAGGTCTCTGCTGCCATCTGGCCTTTCAGGTTTGGATATGACAATGAAGGGTGGTCTAGTCTAGAAAGATCA
GCTCACCTGCTCAATGAAACAGGTGCAGATTTCATAACAATTTTGGAGAGTGATGCTTCTAAGCCCTATATGGGGAACAATGACTTAACC
ATGTGGCTAGGGGAAAAGTTGGGTTTCTATACAGACTTTGGTCCAAGCACAAGGTATCACACTTGGGGGATTATGGCTTTGTCAAGATAC
CCAATTGTGAAATCTGAGCATCACCTTCTTCCGTCACCAGAGGGCGAGATCGCACCAGCCATCACATTGACCGTTAACATTTCGGGCAAG
CTGGTGGATTTTGTCGTGACACACTTTGGGAACCACGAAGATGACCTCGACAGGAAACTGCAGGCTATTGCTGTTTCAAAACTACTGAAA
AGTAGCTCTAATCAAGTGATATTTCTGGGATATATCACTTCAGCACCTGGCTCCAGAGATTATCTACAGCTCACTGAACATGGCAATGTG
AAGGATATCGACAGCACTGATCATGACAGATGGTGTGAATACATTATGTATCGAGGGCTGATCAGGTTGGGTTATGCAAGAATCTCCCAT
GCTGAACTGAGTGATTCAGAAATTCAGATGGCAAAATTTAGGATCCCTGATGACCCCACTAATTATAGAGACAACCAGAAAGTGGTCATA

>In-frame_CWH43_ENST00000513409_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_1978nt
ATGATCTATTACTTTCCTTTGCAAACACTAGAACTCACTGGGCTTGAAGGTTTTAGTATAGCATTTCTTTCTCCAATATTCCTAACAATT
ACTCCTTTCTGGAAATTGGTTAACAAGAAGTGGATGCTAACCCTGCTGAGGATAATCACTATTGGCAGCATAGCCTCCTTCCAGGCTCCA
AATGCCAAACTTCGACTGATGGTTCTTGCGCTTGGGGTGTCTTCCTCACTGATAGTGCAAGCTGTGACTTGGTGGTCAGGAAGTCATTTG
CAAAGGTACCTCAGAATTTGGGGATTCATTTTAGGACAGATTGTTCTTGTTGTTCTACGCATATGGTATACTTCACTAAACCCAATCTGG
AGTTATCAGATGTCCAACAAAGTGATACTGACATTAAGTGCCATAGCCACACTTGATCGTATTGGCACAGATGGTGACTGCAGTAAACCT
GAAGAAAAGAAGACTGGTGAGGTAGCCACGGGGATGGCCTCTAGACCCAACTGGCTGCTGGCAGGGGCTGCTTTTGGTAGCCTTGTGTTC
CTCACCCACTGGGTTTTTGGAGAAGTCTCTCTTGTTTCCAGATGGGCAGTGAGTGGGCATCCACATCCAGGGCCAGATCCTAACCCATTT
GGAGGTGCAGTACTGCTGTGCTTGGCAAGTGGATTGATGCTTCCATCTTGTTTGTGGTTTCGTGGTACTGGTTTGATCTGGTGGGTTACA
GGAACAGCTTCAGCTGCGGGGCTCCTTTACCTGCACACATGGGCAGCTGCTGTGTCTGGCTGTGTCTTCGCCATCTTTACTGCATCCATG
TGGCCCCAAACACTTGGACACCTTATTAACTCAGGGACAAACCCTGGGAAAACCATGACCATTGCCATGATATTTTATCTTCTAGAAATA
TTTTTCTGTGCCTGGTGCACAGCTTTTAAGTTTGTCCCAGGAGGTGTCTACGCTAGAGAAAGATCAGATGTGCTTTTGGGGACAATGATG
TTAATTATCGGGCTGAATATGCTATTTGGTCCTAAGAAAAACCTTGACTTGCTTCTTCAAACAAAAAACAGTTCTAAAGTGCTTTTCAGA
AAGAGTGAAAAATACATGAAACTTTTTCTGTGGCTGCTTGTTGGTGTGGGATTGTTGGGATTAGGACTACGGCATAAAGCCTATGAGAGA
AAACTGGGCAAAGTGGCACCAACCAAAGAGGTCTCTGCTGCCATCTGGCCTTTCAGGTTTGGATATGACAATGAAGGGTGGTCTAGTCTA
GAAAGATCAGCTCACCTGCTCAATGAAACAGGTGCAGATTTCATAACAATTTTGGAGAGTGATGCTTCTAAGCCCTATATGGGGAACAAT
GACTTAACCATGTGGCTAGGGGAAAAGTTGGGTTTCTATACAGACTTTGGTCCAAGCACAAGGTATCACACTTGGGGGATTATGGCTTTG
TCAAGATACCCAATTGTGAAATCTGAGCATCACCTTCTTCCGTCACCAGAGGGCGAGATCGCACCAGCCATCACATTGACCGTTAACATT
TCGGGCAAGCTGGTGGATTTTGTCGTGACACACTTTGGGAACCACGAAGATGACCTCGACAGGAAACTGCAGGCTATTGCTGTTTCAAAA
CTACTGAAAAGTAGCTCTAATCAAGTGATATTTCTGGGATATATCACTTCAGCACCTGGCTCCAGAGATTATCTACAGCTCACTGAACAT
GGCAATGTGAAGGATATCGACAGCACTGATCATGACAGATGGTGTGAATACATTATGTATCGAGGGCTGATCAGGTTGGGTTATGCAAGA
ATCTCCCATGCTGAACTGAGTGATTCAGAAATTCAGATGGCAAAATTTAGGATCCCTGATGACCCCACTAATTATAGAGACAACCAGAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CWH43_ENST00000226432_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_2729nt
CACACTGCCTCGGTTCGGCAAGTGGGTCAGTTGGCTGGGGCTCACTTGGCAACGGGACGCGGGAACGAGGGGCGCGGACGCAGGCCCGGG
AGGACGCGGCGGCGGGAACCTGGGGGCGCAGGGCTAGGGCAGCGGGCCCGACCCGCACGGCTTTCCTGGAAAGCGCTGCCCCTCGCCGCG
GCGATGCCCTCGCTGTGGAGAGAAATCCTCTTGGAGTCGCTGCTGGGATGTGTTTCTTGGTCTCTCTACCATGACCTGGGACCGATGATC
TATTACTTTCCTTTGCAAACACTAGAACTCACTGGGCTTGAAGGTTTTAGTATAGCATTTCTTTCTCCAATATTCCTAACAATTACTCCT
TTCTGGAAATTGGTTAACAAGAAGTGGATGCTAACCCTGCTGAGGATAATCACTATTGGCAGCATAGCCTCCTTCCAGGCTCCAAATGCC
AAACTTCGACTGATGGTTCTTGCGCTTGGGGTGTCTTCCTCACTGATAGTGCAAGCTGTGACTTGGTGGTCAGGAAGTCATTTGCAAAGG
TACCTCAGAATTTGGGGATTCATTTTAGGACAGATTGTTCTTGTTGTTCTACGCATATGGTATACTTCACTAAACCCAATCTGGAGTTAT
CAGATGTCCAACAAAGTGATACTGACATTAAGTGCCATAGCCACACTTGATCGTATTGGCACAGATGGTGACTGCAGTAAACCTGAAGAA
AAGAAGACTGGTGAGGTAGCCACGGGGATGGCCTCTAGACCCAACTGGCTGCTGGCAGGGGCTGCTTTTGGTAGCCTTGTGTTCCTCACC
CACTGGGTTTTTGGAGAAGTCTCTCTTGTTTCCAGATGGGCAGTGAGTGGGCATCCACATCCAGGGCCAGATCCTAACCCATTTGGAGGT
GCAGTACTGCTGTGCTTGGCAAGTGGATTGATGCTTCCATCTTGTTTGTGGTTTCGTGGTACTGGTTTGATCTGGTGGGTTACAGGAACA
GCTTCAGCTGCGGGGCTCCTTTACCTGCACACATGGGCAGCTGCTGTGTCTGGCTGTGTCTTCGCCATCTTTACTGCATCCATGTGGCCC
CAAACACTTGGACACCTTATTAACTCAGGGACAAACCCTGGGAAAACCATGACCATTGCCATGATATTTTATCTTCTAGAAATATTTTTC
TGTGCCTGGTGCACAGCTTTTAAGTTTGTCCCAGGAGGTGTCTACGCTAGAGAAAGATCAGATGTGCTTTTGGGGACAATGATGTTAATT
ATCGGGCTGAATATGCTATTTGGTCCTAAGAAAAACCTTGACTTGCTTCTTCAAACAAAAAACAGTTCTAAAGTGCTTTTCAGAAAGAGT
GAAAAATACATGAAACTTTTTCTGTGGCTGCTTGTTGGTGTGGGATTGTTGGGATTAGGACTACGGCATAAAGCCTATGAGAGAAAACTG
GGCAAAGTGGCACCAACCAAAGAGGTCTCTGCTGCCATCTGGCCTTTCAGGTTTGGATATGACAATGAAGGGTGGTCTAGTCTAGAAAGA
TCAGCTCACCTGCTCAATGAAACAGGTGCAGATTTCATAACAATTTTGGAGAGTGATGCTTCTAAGCCCTATATGGGGAACAATGACTTA
ACCATGTGGCTAGGGGAAAAGTTGGGTTTCTATACAGACTTTGGTCCAAGCACAAGGTATCACACTTGGGGGATTATGGCTTTGTCAAGA
TACCCAATTGTGAAATCTGAGCATCACCTTCTTCCGTCACCAGAGGGCGAGATCGCACCAGCCATCACATTGACCGTTAACATTTCGGGC
AAGCTGGTGGATTTTGTCGTGACACACTTTGGGAACCACGAAGATGACCTCGACAGGAAACTGCAGGCTATTGCTGTTTCAAAACTACTG
AAAAGTAGCTCTAATCAAGTGATATTTCTGGGATATATCACTTCAGCACCTGGCTCCAGAGATTATCTACAGCTCACTGAACATGGCAAT
GTGAAGGATATCGACAGCACTGATCATGACAGATGGTGTGAATACATTATGTATCGAGGGCTGATCAGGTTGGGTTATGCAAGAATCTCC
CATGCTGAACTGAGTGATTCAGAAATTCAGATGGCAAAATTTAGGATCCCTGATGACCCCACTAATTATAGAGACAACCAGAAAGTGGTC
ATAGACCACAGAGAAGTTTCTGAGAAAATTCATTTTAATCCCAGTCAAAGTAAACAAGTATGGAGATACTTGGGATGAGTGAAAAATTAC
ATCATTGGACATGAAGGAGTTTCAACATCCAGCTTCATCTAGGTGGTCATGATTACCTGCATGCTTTGAGCTCAGCAGCAGTCTTCATAA
ACACATTTAAAACAAGATCCTGGGTTTTTGTGGTTTGACTTCTATGGTGTTTTAAAAAAACACAGATTTTTAGTGTTAATATTGTGTAAA
TGTACTCACCTTAGGGATTCATTTGAATGATGGTATTATACCATGATTGTATACAGTTTGTGAAATTGTTGCAAGGGCAAAGATAACTCT
TAAAAAACCGTCGAGATTACAATGCTCTAGAATCAGCATATAAGAAAATAAATGATATCTGCATGTTGAATTGGGGTGGATGGGGGGAGC
AAGCATAATTTTTAAGTGTGAAGCTTTGCATCAAGAAATTATTAAAAAGCTTTTTTTCTCCAGTATTTTCTGTATTATCTTAATGTTTAT

>In-frame_CWH43_ENST00000513409_chr4_49052866_+_OCIAD1_ENST00000509122_chr4_48862742_+_2650nt
AATAAAGGAAAAGACCTAGATTGAAGTCTTCAAGCTGAGTCTGCGAGGCGCCCGCGAGAGACCCCGTCGCCCGAGTTCCCAGCAGCCCTG
GGATTGTGCCCAAGGAGCGCGAATTCTCCTCGTGTCGGCCTTGACCCCGCGCGGCCGGATGTGTTTCTTGGTCTCTCTACCATGACCTGG
GACCGATGATCTATTACTTTCCTTTGCAAACACTAGAACTCACTGGGCTTGAAGGTTTTAGTATAGCATTTCTTTCTCCAATATTCCTAA
CAATTACTCCTTTCTGGAAATTGGTTAACAAGAAGTGGATGCTAACCCTGCTGAGGATAATCACTATTGGCAGCATAGCCTCCTTCCAGG
CTCCAAATGCCAAACTTCGACTGATGGTTCTTGCGCTTGGGGTGTCTTCCTCACTGATAGTGCAAGCTGTGACTTGGTGGTCAGGAAGTC
ATTTGCAAAGGTACCTCAGAATTTGGGGATTCATTTTAGGACAGATTGTTCTTGTTGTTCTACGCATATGGTATACTTCACTAAACCCAA
TCTGGAGTTATCAGATGTCCAACAAAGTGATACTGACATTAAGTGCCATAGCCACACTTGATCGTATTGGCACAGATGGTGACTGCAGTA
AACCTGAAGAAAAGAAGACTGGTGAGGTAGCCACGGGGATGGCCTCTAGACCCAACTGGCTGCTGGCAGGGGCTGCTTTTGGTAGCCTTG
TGTTCCTCACCCACTGGGTTTTTGGAGAAGTCTCTCTTGTTTCCAGATGGGCAGTGAGTGGGCATCCACATCCAGGGCCAGATCCTAACC
CATTTGGAGGTGCAGTACTGCTGTGCTTGGCAAGTGGATTGATGCTTCCATCTTGTTTGTGGTTTCGTGGTACTGGTTTGATCTGGTGGG
TTACAGGAACAGCTTCAGCTGCGGGGCTCCTTTACCTGCACACATGGGCAGCTGCTGTGTCTGGCTGTGTCTTCGCCATCTTTACTGCAT
CCATGTGGCCCCAAACACTTGGACACCTTATTAACTCAGGGACAAACCCTGGGAAAACCATGACCATTGCCATGATATTTTATCTTCTAG
AAATATTTTTCTGTGCCTGGTGCACAGCTTTTAAGTTTGTCCCAGGAGGTGTCTACGCTAGAGAAAGATCAGATGTGCTTTTGGGGACAA
TGATGTTAATTATCGGGCTGAATATGCTATTTGGTCCTAAGAAAAACCTTGACTTGCTTCTTCAAACAAAAAACAGTTCTAAAGTGCTTT
TCAGAAAGAGTGAAAAATACATGAAACTTTTTCTGTGGCTGCTTGTTGGTGTGGGATTGTTGGGATTAGGACTACGGCATAAAGCCTATG
AGAGAAAACTGGGCAAAGTGGCACCAACCAAAGAGGTCTCTGCTGCCATCTGGCCTTTCAGGTTTGGATATGACAATGAAGGGTGGTCTA
GTCTAGAAAGATCAGCTCACCTGCTCAATGAAACAGGTGCAGATTTCATAACAATTTTGGAGAGTGATGCTTCTAAGCCCTATATGGGGA
ACAATGACTTAACCATGTGGCTAGGGGAAAAGTTGGGTTTCTATACAGACTTTGGTCCAAGCACAAGGTATCACACTTGGGGGATTATGG
CTTTGTCAAGATACCCAATTGTGAAATCTGAGCATCACCTTCTTCCGTCACCAGAGGGCGAGATCGCACCAGCCATCACATTGACCGTTA
ACATTTCGGGCAAGCTGGTGGATTTTGTCGTGACACACTTTGGGAACCACGAAGATGACCTCGACAGGAAACTGCAGGCTATTGCTGTTT
CAAAACTACTGAAAAGTAGCTCTAATCAAGTGATATTTCTGGGATATATCACTTCAGCACCTGGCTCCAGAGATTATCTACAGCTCACTG
AACATGGCAATGTGAAGGATATCGACAGCACTGATCATGACAGATGGTGTGAATACATTATGTATCGAGGGCTGATCAGGTTGGGTTATG
CAAGAATCTCCCATGCTGAACTGAGTGATTCAGAAATTCAGATGGCAAAATTTAGGATCCCTGATGACCCCACTAATTATAGAGACAACC
AGAAAGTGGTCATAGACCACAGAGAAGTTTCTGAGAAAATTCATTTTAATCCCAGTCAAAGTAAACAAGTATGGAGATACTTGGGATGAG
TGAAAAATTACATCATTGGACATGAAGGAGTTTCAACATCCAGCTTCATCTAGGTGGTCATGATTACCTGCATGCTTTGAGCTCAGCAGC
AGTCTTCATAAACACATTTAAAACAAGATCCTGGGTTTTTGTGGTTTGACTTCTATGGTGTTTTAAAAAAACACAGATTTTTAGTGTTAA
TATTGTGTAAATGTACTCACCTTAGGGATTCATTTGAATGATGGTATTATACCATGATTGTATACAGTTTGTGAAATTGTTGCAAGGGCA
AAGATAACTCTTAAAAAACCGTCGAGATTACAATGCTCTAGAATCAGCATATAAGAAAATAAATGATATCTGCATGTTGAATTGGGGTGG
ATGGGGGGAGCAAGCATAATTTTTAAGTGTGAAGCTTTGCATCAAGAAATTATTAAAAAGCTTTTTTTCTCCAGTATTTTCTGTATTATC


Top

FusionGenePPI for CWH43_OCIAD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CWH43OCIAD1UBC, FLOT1, ELAVL1, SDHB, ATF7, SHMT2, MOV10, NXF1, BLVRA, RGL4, GNAT2, GNAS, LANCL1, LPAR1, CPVL, AKAP14, UNK, PCBP1, TMEM67, XPO1, TIMMDC1, RAB5C, OCIAD1, CHCHD3, FUNDC2, AFG3L2, NDUFA4, STOML2, CISD1, PMPCB, CLPB, CYB5R3, COX6A1, TOMM5, ABCD3, UQCC2, C2orf47, USMG5, ATP5E, COX6C, IMMT, NRD1, TIMM44, NDUFV1, ECH1, ATP5H, ATAD3A, SLC25A1, NDUFS8, NDUFS2, MTX1, ATAD1, MTCH2, ATP5C1, COX7A2, ATP5O, TOMM20, TOMM40, YME1L1, C1QBP, BAX, NDUFS3, ATP5J, TIMM50, SCO1, POLDIP2, NDUFA9, NDUFB1, CTDNEP1, IPPK, SYCE3, UST, EXOC8, CLU, RALB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CWH43_OCIAD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CWH43_OCIAD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource