FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8787

FusionGeneSummary for CTDSPL_TNRC6B

check button Fusion gene summary
Fusion gene informationFusion gene name: CTDSPL_TNRC6B
Fusion gene ID: 8787
HgeneTgene
Gene symbol

CTDSPL

TNRC6B

Gene ID

10217

23112

Gene nameCTD small phosphatase liketrinucleotide repeat containing 6B
SynonymsC3orf8|HYA22|PSR1|RBSP3|SCP3-
Cytomap

3p22.2

22q13.1

Type of geneprotein-codingprotein-coding
DescriptionCTD small phosphatase-like proteinCTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-likeCTDSP-likeNIF-like proteinNLI-interacting factor 1RB protein serine phosphatase from chromosome 3carboxy-terminal domain RNA polytrinucleotide repeat-containing gene 6B protein
Modification date2018052320180519
UniProtAcc

O15194

Q9UPQ9

Ensembl transtripts involved in fusion geneENST00000443503, ENST00000273179, 
ENST00000310189, 
ENST00000301923, 
ENST00000402203, ENST00000454349, 
ENST00000335727, ENST00000497559, 
Fusion gene scores* DoF score5 X 4 X 5=1007 X 11 X 5=385
# samples 511
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/385*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CTDSPL [Title/Abstract] AND TNRC6B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHYMTCGA-XM-A8RF-01ACTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000443503ENST00000301923CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000443503ENST00000402203CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000443503ENST00000454349CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000443503ENST00000335727CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
5CDS-intronENST00000443503ENST00000497559CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000273179ENST00000301923CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000273179ENST00000402203CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000273179ENST00000454349CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
In-frameENST00000273179ENST00000335727CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
5CDS-intronENST00000273179ENST00000497559CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
intron-3CDSENST00000310189ENST00000301923CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
intron-3CDSENST00000310189ENST00000402203CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
intron-3CDSENST00000310189ENST00000454349CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
intron-3CDSENST00000310189ENST00000335727CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+
intron-intronENST00000310189ENST00000497559CTDSPLchr3

37988702

+TNRC6Bchr22

40717094

+

Top

FusionProtFeatures for CTDSPL_TNRC6B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CTDSPL

O15194

TNRC6B

Q9UPQ9

Recruited by REST to neuronal genes that contain RE-1elements, leading to neuronal gene silencing in non-neuronal cells(By similarity). Preferentially catalyzes the dephosphorylation of'Ser-5' within the tandem 7 residue repeats in the C-terminaldomain (CTD) of the largest RNA polymerase II subunit POLR2A.Negatively regulates RNA polymerase II transcription, possibly bycontrolling the transition from initiation/capping to processivetranscript elongation. {ECO:0000250, ECO:0000269|PubMed:12721286}. Plays a role in RNA-mediated gene silencing by bothmicro-RNAs (miRNAs) and short interfering RNAs (siRNAs). Requiredfor miRNA-dependent translational repression and siRNA-dependentendonucleolytic cleavage of complementary mRNAs by argonautefamily proteins. As scaffoldng protein associates with argonauteproteins bound to partially complementary mRNAs and simultaneouslycan recruit CCR4-NOT and PAN deadenylase complexes.{ECO:0000269|PubMed:16289642, ECO:0000269|PubMed:19167051,ECO:0000269|PubMed:19304925, ECO:0000269|PubMed:21981923}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+21241150_12208541030Compositional biasNote=Gln-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+21241150_12208541030Compositional biasNote=Gln-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+21241648_17208541030DomainNote=RRM
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+18211648_172015481724DomainNote=RRM
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+21241648_17208541030DomainNote=RRM
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+21241472_14908541030RegionNote=PABPC1-interacting motif-2 (PAM2)
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+21241472_14908541030RegionNote=PABPC1-interacting motif-2 (PAM2)

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCTDSPLchr3:37988702chr22:40717094ENST00000273179+28102_26078277DomainFCP1 homology
HgeneCTDSPLchr3:37988702chr22:40717094ENST00000443503+27102_26078266DomainFCP1 homology
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+21241_398541030Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+18211_3915481724Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+21241_398541030Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+20231_3916581834Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+2124825_8808541030Compositional biasNote=Pro-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+18211150_122015481724Compositional biasNote=Gln-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+1821825_88015481724Compositional biasNote=Pro-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+2124825_8808541030Compositional biasNote=Pro-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+20231150_122016581834Compositional biasNote=Gln-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+2023825_88016581834Compositional biasNote=Pro-rich
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+20231648_172016581834DomainNote=RRM
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+18211472_149015481724RegionNote=PABPC1-interacting motif-2 (PAM2)
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+20231472_149016581834RegionNote=PABPC1-interacting motif-2 (PAM2)


Top

FusionGeneSequence for CTDSPL_TNRC6B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_254aa
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKIDGSTLRTICMQ
HGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_762nt
ATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGC
AACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCC
AGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAG
CATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAA
ACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCT
CAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGA
CCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCT
TCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_13568nt
CGCGGCTCCGGGGTTCATGGTGACGAGGCGGCGGCCGCTCGAGCCCAGCGGCGGCGGCGGCGGGAGCTGGGGCGCGGGCCCGGGCCGCCT
CTCCCAGAGCGCGGGGCCGGGCGGCGGGCGCGCCCAGGCAGCGGCTGCGAGCGCCCCCCCGCGCCGCGCCCCCGCGCCCCCCGCGCCGCG
CCCCCGCGCGCTTGGCTTGCGGGGGGCCGGGCCTGCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTG
ACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGC
AGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTG
GAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAAT
CTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAAC
ACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGT
GCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACT
GGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCT
AGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCG
GATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTT
TCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTT
GCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAA
CCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTT
TCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCT
TAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAAC
AAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTG
CCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTT
CTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTAT
TTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGC
TTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAG
AGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGT
GAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATG
ATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGT
TACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTA
CTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTA
ACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCA
GGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTC
GGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACC
AACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAG
ATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACAT
TTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGA
GTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGG
GTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTT
CTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAG
CCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAA
TTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGC
AAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGA
GCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTC
CTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTT
ACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTA
AAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAAC
AGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTT
TGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGA
AAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACAT
AGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGC
TCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCC
ATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAA
AGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGG
AAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATG
TCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCT
ACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAG
TTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAG
CTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCT
TCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCA
TAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCT
TATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGA
CAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTT
CCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATG
TCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATT
CAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAAC
ATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACAT
CTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAG
ACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAA
ATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTG
TTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAG
CAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTT
CCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGC
ACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTT
TTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATAT
TCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGT
AAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTT
CCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATC
TTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTA
TGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTC
CTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCA
TGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAG
AAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACC
CTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTT
TTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAA
CAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGG
TGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGAC
CAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAA
AAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTT
TAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGA
CAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTT
AAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAA
TATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAG
TTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTT
CCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGG
ACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAA
CAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACA
CTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTT
AAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGT
CAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTA
GAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGG
TTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCAC
TGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCA
CGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTAT
TACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCA
GAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTT
CTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCC
TTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATT
ATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACA
TGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAG
GGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTA
AGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAG
TTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTT
CTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCT
TTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAG
TTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTG
CTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTA
ACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGC
GAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATC
ACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACA
AAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCT
CTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAA
GTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTT
AAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAG
ACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGA
GGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTC
CCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGT
GTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCAT
CTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTC
CACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAG
AAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACT
TGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAA
GCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAG
CAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGC
CCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCC
ACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGG
GTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACC
ACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGA
GACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAA
AACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACA
TTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACT
ATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCC
TACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAA
GTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGC
AGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAAT
CCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTA
AGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTA
GATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGG
TTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCA
TGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAAT
AAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGC
TGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGA
ATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAG
CTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAA

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_1121nt
CGCGGCTCCGGGGTTCATGGTGACGAGGCGGCGGCCGCTCGAGCCCAGCGGCGGCGGCGGCGGGAGCTGGGGCGCGGGCCCGGGCCGCCT
CTCCCAGAGCGCGGGGCCGGGCGGCGGGCGCGCCCAGGCAGCGGCTGCGAGCGCCCCCCCGCGCCGCGCCCCCGCGCCCCCCGCGCCGCG
CCCCCGCGCGCTTGGCTTGCGGGGGGCCGGGCCTGCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTG
ACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGC
AGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTG
GAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAAT
CTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAAC
ACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGT
GCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACT
GGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCT
AGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCG
GATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTT

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_13568nt
CGCGGCTCCGGGGTTCATGGTGACGAGGCGGCGGCCGCTCGAGCCCAGCGGCGGCGGCGGCGGGAGCTGGGGCGCGGGCCCGGGCCGCCT
CTCCCAGAGCGCGGGGCCGGGCGGCGGGCGCGCCCAGGCAGCGGCTGCGAGCGCCCCCCCGCGCCGCGCCCCCGCGCCCCCCGCGCCGCG
CCCCCGCGCGCTTGGCTTGCGGGGGGCCGGGCCTGCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTG
ACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGC
AGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTG
GAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAAT
CTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAAC
ACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGT
GCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACT
GGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCT
AGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCG
GATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTT
TCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTT
GCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAA
CCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTT
TCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCT
TAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAAC
AAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTG
CCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTT
CTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTAT
TTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGC
TTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAG
AGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGT
GAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATG
ATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGT
TACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTA
CTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTA
ACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCA
GGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTC
GGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACC
AACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAG
ATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACAT
TTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGA
GTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGG
GTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTT
CTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAG
CCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAA
TTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGC
AAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGA
GCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTC
CTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTT
ACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTA
AAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAAC
AGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTT
TGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGA
AAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACAT
AGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGC
TCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCC
ATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAA
AGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGG
AAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATG
TCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCT
ACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAG
TTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAG
CTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCT
TCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCA
TAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCT
TATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGA
CAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTT
CCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATG
TCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATT
CAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAAC
ATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACAT
CTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAG
ACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAA
ATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTG
TTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAG
CAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTT
CCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGC
ACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTT
TTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATAT
TCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGT
AAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTT
CCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATC
TTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTA
TGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTC
CTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCA
TGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAG
AAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACC
CTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTT
TTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAA
CAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGG
TGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGAC
CAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAA
AAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTT
TAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGA
CAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTT
AAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAA
TATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAG
TTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTT
CCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGG
ACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAA
CAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACA
CTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTT
AAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGT
CAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTA
GAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGG
TTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCAC
TGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCA
CGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTAT
TACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCA
GAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTT
CTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCC
TTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATT
ATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACA
TGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAG
GGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTA
AGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAG
TTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTT
CTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCT
TTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAG
TTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTG
CTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTA
ACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGC
GAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATC
ACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACA
AAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCT
CTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAA
GTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTT
AAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAG
ACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGA
GGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTC
CCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGT
GTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCAT
CTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTC
CACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAG
AAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACT
TGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAA
GCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAG
CAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGC
CCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCC
ACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGG
GTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACC
ACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGA
GACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAA
AACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACA
TTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACT
ATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCC
TACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAA
GTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGC
AGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAAT
CCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTA
AGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTA
GATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGG
TTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCA
TGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAAT
AAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGC
TGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGA
ATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAG
CTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAA

>In-frame_CTDSPL_ENST00000443503_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_13569nt
CGCGGCTCCGGGGTTCATGGTGACGAGGCGGCGGCCGCTCGAGCCCAGCGGCGGCGGCGGCGGGAGCTGGGGCGCGGGCCCGGGCCGCCT
CTCCCAGAGCGCGGGGCCGGGCGGCGGGCGCGCCCAGGCAGCGGCTGCGAGCGCCCCCCCGCGCCGCGCCCCCGCGCCCCCCGCGCCGCG
CCCCCGCGCGCTTGGCTTGCGGGGGGCCGGGCCTGCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTG
ACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGGGCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGC
AGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTG
GAGGAGAATGGTGGGCTTCAGAAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAAT
CTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAAC
ACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGT
GCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACT
GGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCT
AGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCG
GATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTT
TCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTT
GCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAA
CCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTT
TCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCT
TAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAAC
AAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTG
CCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTT
CTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTAT
TTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGC
TTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAG
AGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGT
GAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATG
ATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGT
TACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTA
CTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTA
ACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCA
GGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTC
GGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACC
AACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAG
ATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACAT
TTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGA
GTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGG
GTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTT
CTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAG
CCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAA
TTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGC
AAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGA
GCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTC
CTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTT
ACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTA
AAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAAC
AGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTT
TGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGA
AAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACAT
AGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGC
TCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCC
ATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAA
AGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGG
AAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATG
TCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCT
ACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAG
TTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAG
CTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCT
TCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCA
TAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCT
TATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGA
CAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTT
CCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATG
TCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATT
CAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAAC
ATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACAT
CTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAG
ACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAA
ATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTG
TTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAG
CAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTT
CCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGC
ACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTT
TTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATAT
TCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGT
AAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTT
CCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATC
TTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTA
TGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTC
CTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCA
TGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAG
AAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACC
CTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTT
TTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAA
CAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGG
TGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGAC
CAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAA
AAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTT
TAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGA
CAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTT
AAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAA
TATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAG
TTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTT
CCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGG
ACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAA
CAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACA
CTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTT
AAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGT
CAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTA
GAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGG
TTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCAC
TGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCA
CGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTAT
TACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCA
GAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTT
CTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCC
TTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATT
ATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACA
TGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAG
GGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTA
AGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAG
TTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTT
CTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCT
TTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAG
TTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTG
CTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTA
ACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGC
GAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATC
ACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACA
AAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCT
CTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAA
GTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTT
AAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAG
ACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGA
GGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTC
CCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGT
GTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCAT
CTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTC
CACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAG
AAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACT
TGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAA
GCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAG
CAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGC
CCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCC
ACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGG
GTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACC
ACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGA
GACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAA
AACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACA
TTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACT
ATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCC
TACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAA
GTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGC
AGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAAT
CCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTA
AGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTA
GATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGG
TTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCA
TGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAAT
AAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGC
TGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGA
ATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAG
CTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000301923_chr22_40717094_+_13354nt
GCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGG
GCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTG
ATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGT
CAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCA
CCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATG
AAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCG
GCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCA
GCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCC
ATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCTGAACTTAGAACTTTCAACTCTGAC
CTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAA
AAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAA
TATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGACAATGTGAAGCAAGTACACATACC
ATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATA
TATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCA
AAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGA
AAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACG
TGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCA
GAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTTTAACTATGAGAACACACAGGCCCG
GAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCAT
TTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCA
GGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAA
GTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCC
CTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATT
TTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTG
TGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCG
TTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCAC
CTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATC
AATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATGTACTTATGTCGGAATCAAAATGTA
TCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTA
GCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAGCAAATACCTGCCCATTCCAACCCT
TGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATA
CAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAA
GTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCA
AAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTG
CAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCACCACCGTGCCCCTTCCACCACTGTT
CCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGA
GCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGAC
CCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTT
AGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATAATGAGGGATTTGAAATATGTAAAA
ATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTA
TATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTT
CCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGTTTATTTAACCATATCTTATCCTAG
AGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAA
AAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTTTTTAAAAATTATCAATTTAGCAGC
AACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTT
TAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATT
TTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAA
AAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGTTAATAATTTTTGGAACAAATTTTA
AATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAG
AAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGA
TCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTC
CTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGG
TAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATACACCCAGACATCCTGAGCAAGGGGG
ACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCA
AAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTC
CTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTG
GGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGC
TGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCT
TTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTC
TGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTT
TTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACATCACAAACTTGGTTTCTACCTACC
ACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTAT
CATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCTCATGTAACATCTCTGATCCCTCAG
TCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAAT
CAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGT
AAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGG
TATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTAACACATATATCTCGCAGAAACTAG
AAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACA
GCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGA
AAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATA
GCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAG
CTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAA
AAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACTATACTTCTTAGTGTTACTGCAAAA
AAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGC
GGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCT
GCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAGATACACATAATGCTATTGAGGACA
TTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGC
CAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCA
CATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAATTCAACATCGACCCTCCCTAACCTG
CTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAG
CTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGAGTGATTGTGGCATACCCCTAATAT
TTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTG
CCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGT
ACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGAT
CAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACT
GTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCT
TTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGA
GCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCC
AGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGG
ACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTT
ACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATA
AATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTA
CAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCC
TGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGA
GGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCT
GTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTGGAATATGGTGATACTTGTGACACA
TTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGG
CCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAG
ATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTG
TCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATT
TCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAG
ATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGTGAATTTTGATACTGAATTTAAGAA
GAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTG
AATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTG
TGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCC
TCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGAT
CCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCA
GAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCT
CCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGG
GCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAA
TGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATC
ATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCA
TGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGG
CATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCAC
ACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAA
AATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTT
TTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGG
TTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGG
TGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGG
TGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGC
TTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACA
TAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTG
TCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGT
TCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTG
TAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACC
ACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAA
TGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTT
TGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGT
GACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATT
TTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCT
CCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCACACACCAGTGACCAAAGTGTATGC
AGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTA
ATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGAT
ACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTG
TTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTGTCTCCATTTAGATGGAGATATAAA
TGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCA
CTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCC
TTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTA
AAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAA
CCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTT
TACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAA
GGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCT
CATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTT
TCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAAACTCTACTAATGTACAAATAAGCT
GAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAA
CAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGA
TGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTA
TTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATATTTTTGGGTTCCTGGAAAAAAAAG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000402203_chr22_40717094_+_907nt
GCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGG
GCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTG
ATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGT
CAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCA
CCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATG
AAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCG
GCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCA
GCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCC
ATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCTGAACTTAGAACTTTCAACTCTGAC
CTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAA

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000454349_chr22_40717094_+_13354nt
GCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGG
GCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTG
ATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGT
CAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCA
CCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATG
AAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCG
GCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCA
GCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCC
ATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCTGAACTTAGAACTTTCAACTCTGAC
CTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAA
AAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAA
TATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGACAATGTGAAGCAAGTACACATACC
ATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATA
TATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCA
AAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGA
AAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACG
TGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCA
GAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTTTAACTATGAGAACACACAGGCCCG
GAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCAT
TTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCA
GGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAA
GTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCC
CTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATT
TTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTG
TGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCG
TTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCAC
CTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATC
AATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATGTACTTATGTCGGAATCAAAATGTA
TCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTA
GCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAGCAAATACCTGCCCATTCCAACCCT
TGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATA
CAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAA
GTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCA
AAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTG
CAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCACCACCGTGCCCCTTCCACCACTGTT
CCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGA
GCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGAC
CCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTT
AGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATAATGAGGGATTTGAAATATGTAAAA
ATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTA
TATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTT
CCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGTTTATTTAACCATATCTTATCCTAG
AGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAA
AAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTTTTTAAAAATTATCAATTTAGCAGC
AACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTT
TAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATT
TTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAA
AAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGTTAATAATTTTTGGAACAAATTTTA
AATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAG
AAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGA
TCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTC
CTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGG
TAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATACACCCAGACATCCTGAGCAAGGGGG
ACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCA
AAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTC
CTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTG
GGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGC
TGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCT
TTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTC
TGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTT
TTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACATCACAAACTTGGTTTCTACCTACC
ACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTAT
CATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCTCATGTAACATCTCTGATCCCTCAG
TCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAAT
CAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGT
AAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGG
TATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTAACACATATATCTCGCAGAAACTAG
AAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACA
GCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGA
AAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATA
GCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAG
CTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAA
AAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACTATACTTCTTAGTGTTACTGCAAAA
AAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGC
GGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCT
GCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAGATACACATAATGCTATTGAGGACA
TTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGC
CAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCA
CATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAATTCAACATCGACCCTCCCTAACCTG
CTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAG
CTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGAGTGATTGTGGCATACCCCTAATAT
TTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTG
CCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGT
ACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGAT
CAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACT
GTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCT
TTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGA
GCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCC
AGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGG
ACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTT
ACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATA
AATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTA
CAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCC
TGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGA
GGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCT
GTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTGGAATATGGTGATACTTGTGACACA
TTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGG
CCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAG
ATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTG
TCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATT
TCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAG
ATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGTGAATTTTGATACTGAATTTAAGAA
GAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTG
AATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTG
TGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCC
TCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGAT
CCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCA
GAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCT
CCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGG
GCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAA
TGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATC
ATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCA
TGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGG
CATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCAC
ACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAA
AATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTT
TTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGG
TTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGG
TGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGG
TGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGC
TTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACA
TAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTG
TCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGT
TCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTG
TAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACC
ACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAA
TGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTT
TGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGT
GACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATT
TTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCT
CCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCACACACCAGTGACCAAAGTGTATGC
AGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTA
ATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGAT
ACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTG
TTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTGTCTCCATTTAGATGGAGATATAAA
TGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCA
CTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCC
TTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTA
AAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAA
CCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTT
TACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAA
GGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCT
CATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTT
TCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAAACTCTACTAATGTACAAATAAGCT
GAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAA
CAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGA
TGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTA
TTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATATTTTTGGGTTCCTGGAAAAAAAAG

>In-frame_CTDSPL_ENST00000273179_chr3_37988702_+_TNRC6B_ENST00000335727_chr22_40717094_+_13355nt
GCGGGCGGCCGCCGCGCCGCGCACCCATGGACGGCCCGGCCATCATCACCCAGGTGACCAACCCCAAGGAGGACGAGGGCCGGTTGCCGG
GCGCGGGCGAGAAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTG
ATTACAATGTGGAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGATTGATGGGT
CAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGATACAGCA
CCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACTGATGATG
AAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCG
GCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCA
GCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCC
ATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCTGAACTTAGAACTTTCAACTCTGAC
CTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAA
AAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAA
TATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGACAATGTGAAGCAAGTACACATACC
ATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATA
TATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCA
AAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGA
AAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACG
TGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCA
GAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTTTAACTATGAGAACACACAGGCCCG
GAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCAT
TTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCA
GGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAA
GTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCC
CTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATT
TTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTG
TGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCG
TTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCAC
CTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATC
AATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATGTACTTATGTCGGAATCAAAATGTA
TCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTA
GCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAGCAAATACCTGCCCATTCCAACCCT
TGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATA
CAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAA
GTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCA
AAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTG
CAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCACCACCGTGCCCCTTCCACCACTGTT
CCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGA
GCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGAC
CCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTT
AGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATAATGAGGGATTTGAAATATGTAAAA
ATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTA
TATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTT
CCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGTTTATTTAACCATATCTTATCCTAG
AGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAA
AAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTTTTTAAAAATTATCAATTTAGCAGC
AACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTT
TAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATT
TTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAA
AAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGTTAATAATTTTTGGAACAAATTTTA
AATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAG
AAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGA
TCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTC
CTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGG
TAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATACACCCAGACATCCTGAGCAAGGGGG
ACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCA
AAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTC
CTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTG
GGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGC
TGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCT
TTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTC
TGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTT
TTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACATCACAAACTTGGTTTCTACCTACC
ACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTAT
CATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCTCATGTAACATCTCTGATCCCTCAG
TCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAAT
CAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGT
AAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGG
TATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTAACACATATATCTCGCAGAAACTAG
AAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACA
GCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGA
AAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATA
GCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAG
CTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAA
AAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACTATACTTCTTAGTGTTACTGCAAAA
AAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGC
GGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCT
GCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAGATACACATAATGCTATTGAGGACA
TTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGC
CAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCA
CATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAATTCAACATCGACCCTCCCTAACCTG
CTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAG
CTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGAGTGATTGTGGCATACCCCTAATAT
TTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTG
CCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGT
ACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGAT
CAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACT
GTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCT
TTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGA
GCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCC
AGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGG
ACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTT
ACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATA
AATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTA
CAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCC
TGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGA
GGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCT
GTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTGGAATATGGTGATACTTGTGACACA
TTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGG
CCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAG
ATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTG
TCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATT
TCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAG
ATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGTGAATTTTGATACTGAATTTAAGAA
GAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTG
AATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTG
TGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCC
TCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGAT
CCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCA
GAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCT
CCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGG
GCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAA
TGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATC
ATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCA
TGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGG
CATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCAC
ACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAA
AATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTT
TTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGG
TTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGG
TGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGG
TGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGC
TTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACA
TAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTG
TCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGT
TCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTG
TAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACC
ACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAA
TGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTT
TGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGT
GACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATT
TTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCT
CCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCACACACCAGTGACCAAAGTGTATGC
AGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTA
ATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGAT
ACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTG
TTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTGTCTCCATTTAGATGGAGATATAAA
TGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCA
CTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCC
TTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTA
AAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAA
CCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTT
TACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAA
GGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCT
CATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTT
TCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAAACTCTACTAATGTACAAATAAGCT
GAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAA
CAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGA
TGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTA
TTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATATTTTTGGGTTCCTGGAAAAAAAAG


Top

FusionGenePPI for CTDSPL_TNRC6B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CTDSPLSNAI1, ELAVL1, CTDSP1, CDCA3, TBC1D4, ARVCF, CADM1, RFTN1, PACS1, DAB2IP, ARHGAP39, CD44, ABCC1, ATP2B4, NOTCH1, PVRL2, MCAM, ITGA5, USP31, C2CD4C, TBC1D10B, TIAM1, ITGA6, KIRREL, SPTBN2, PPP1R9A, CDC42EP1, TMEM2, CACHD1, MICAL3, ANK3, FMN2, ROBO1, MPZL1, ADD2, PALM2, NUMBL, AKAP5, SLC30A1, KIAA1549, CTNNA1, FLVCR1, SLC29A1, CXADR, FAM171B, TTC7B, PCDH7, MARVELD2, NF2, SLC39A6, BASP1, CNNM3, SLC39A10, CLCN7, GPRIN3, ESYT2, FAM171A1, LPHN2, RELL1, SLC12A7, NUMB, CEP89, SLC12A2, CTNND1, DTNA, CCDC8, SLC38A1, TJP1, ZDHHC5, PALM, EGFR, PTPN14, TULP3, FAM129B, GPRIN1, HSPA12A, ATP2B1, EFR3B, SLC3A2, ARL13B, PSD3, MBP, FGFR2TNRC6BAGO1, AGO2, GIGYF2, UBC, AGO3, AGO4, PABPC1, CUL3, CUL2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, UBQLN4, LATS2, SAV1, CARM1, APBA3, CSK, FBRS, GMPS, NUP155, FLAD1, CHEK1, GARS, TRIM65, PFAS, NXF1, BMI1, CNOT1, CNOT2, CNOT6, CNOT6L, CNOT7, CNOT8, CNOT3, PAN3, BTRC, MED4, MED23, SSX2IP, OFD1, B9D2, MKS1, CEP97, CEP104, CEP120, CEP152, CNTROB, CEP128, CEP135, CEP44, CEP63, CNTRL, FBF1, NINL, NIN, NPHP1, ODF2, RPGRIP1L, SCLT1, SASS6, RPGRIP1, STIL, CENPJ, CLTC, KAT6A, GTSE1, RNASEH2B, G3BP1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000301923+21241_9948541030argonaute proteins
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000335727+18211_99415481724argonaute proteins
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000402203+21241_9948541030argonaute proteins
TgeneTNRC6Bchr3:37988702chr22:40717094ENST00000454349+20231_99416581834argonaute proteins


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CTDSPL_TNRC6B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CTDSPL_TNRC6B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTNRC6BC0032460Polycystic Ovary Syndrome1CTD_human