FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8668

FusionGeneSummary for CSPG4_MYO1D

check button Fusion gene summary
Fusion gene informationFusion gene name: CSPG4_MYO1D
Fusion gene ID: 8668
HgeneTgene
Gene symbol

CSPG4

MYO1D

Gene ID

1464

4642

Gene namechondroitin sulfate proteoglycan 4myosin ID
SynonymsHMW-MAA|MCSP|MCSPG|MEL-CSPG|MSK16|NG2PPP1R108|myr4
Cytomap

15q24.2

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionchondroitin sulfate proteoglycan 4chondroitin sulfate proteoglycan 4 (melanoma-associated)chondroitin sulfate proteoglycan NG2melanoma chondroitin sulfate proteoglycanmelanoma-associated chondroitin sulfate proteoglycanunconventional myosin-Idmyosin-I gammaprotein phosphatase 1, regulatory subunit 108
Modification date2018052220180519
UniProtAcc

Q6UVK1

O94832

Ensembl transtripts involved in fusion geneENST00000308508, ENST00000318217, 
ENST00000394649, ENST00000579584, 
ENST00000584232, ENST00000583621, 
Fusion gene scores* DoF score2 X 2 X 2=815 X 9 X 8=1080
# samples 215
** MAII scorelog2(2/8*10)=1.32192809488736log2(15/1080*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CSPG4 [Title/Abstract] AND MYO1D [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCSPG4

GO:0035556

intracellular signal transduction

10587647

HgeneCSPG4

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

10587647

TgeneMYO1D

GO:0010923

negative regulation of phosphatase activity

19389623


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-FX-A3TO-01ACSPG4chr15

76005009

-MYO1Dchr17

31082680

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308508ENST00000318217CSPG4chr15

76005009

-MYO1Dchr17

31082680

-
In-frameENST00000308508ENST00000394649CSPG4chr15

76005009

-MYO1Dchr17

31082680

-
In-frameENST00000308508ENST00000579584CSPG4chr15

76005009

-MYO1Dchr17

31082680

-
5CDS-5UTRENST00000308508ENST00000584232CSPG4chr15

76005009

-MYO1Dchr17

31082680

-
5CDS-intronENST00000308508ENST00000583621CSPG4chr15

76005009

-MYO1Dchr17

31082680

-

Top

FusionProtFeatures for CSPG4_MYO1D


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CSPG4

Q6UVK1

MYO1D

O94832

Proteoglycan playing a role in cell proliferation andmigration which stimulates endothelial cells motility duringmicrovascular morphogenesis. May also inhibit neurite outgrowthand growth cone collapse during axon regeneration. Cell surfacereceptor for collagen alpha 2(VI) which may confer cells abilityto migrate on that substrate. Binds through its extracellular N-terminus growth factors, extracellular matrix proteases modulatingtheir activity. May regulate MPP16-dependent degradation andinvasion of type I collagen participating in melanoma cellsinvasion properties. May modulate the plasminogen system byenhancing plasminogen activation and inhibiting angiostatin.Functions also as a signal transducing protein by binding throughits cytoplasmic C-terminus scaffolding and signaling proteins. Maypromote retraction fiber formation and cell polarization throughRho GTPase activation. May stimulate alpha-4, beta-1 integrin-mediated adhesion and spreading by recruiting and activating asignaling cascade through CDC42, ACK1 and BCAR1. May activate FAKand ERK1/ERK2 signaling cascades. {ECO:0000269|PubMed:10587647,ECO:0000269|PubMed:11278606, ECO:0000269|PubMed:15210734}. Myosins are actin-based motor molecules with ATPaseactivity. Unconventional myosins serve in intracellular movements.Their highly divergent tails are presumed to bind to membranouscompartments, which would be moved relative to actin filaments (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-922699_7194321007DomainIQ 1
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-922721_7414321007DomainIQ 2
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-922812_10054321007DomainTH1
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-922572_5944321007RegionActin-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110639_1586292323Compositional biasNote=Gly/Ser-rich (glycosaminoglycan attachment domain)
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110202_380292323DomainLaminin G-like 2
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-11030_192292323DomainLaminin G-like 1
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1102320_2322292323MotifNote=PDZ-binding
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101586_2221292323RegionNeurite growth inhibition
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101587_2221292323RegionNote=Cysteine-containing
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-11030_639292323RegionNeurite growth inhibition
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101018_1110292323RepeatCSPG 6
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101126_1216292323RepeatCSPG 7
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101238_1337292323RepeatCSPG 8
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101356_1449292323RepeatCSPG 9
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101473_1563292323RepeatCSPG 10
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101581_1679292323RepeatCSPG 11
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101704_1803292323RepeatCSPG 12
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101832_1924292323RepeatCSPG 13
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1101941_2029292323RepeatCSPG 14
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1102038_2147292323RepeatCSPG 15
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110428_523292323RepeatCSPG 1
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110553_645292323RepeatCSPG 2
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110662_764292323RepeatCSPG 3
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110783_878292323RepeatCSPG 4
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110898_989292323RepeatCSPG 5
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1102246_2322292323Topological domainCytoplasmic
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-11030_2224292323Topological domainExtracellular
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-1102225_2245292323TransmembraneHelical
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-9229_6954321007DomainMyosin motor
TgeneMYO1Dchr15:76005009chr17:31082680ENST00000318217-922102_1094321007Nucleotide bindingATP


Top

FusionGeneSequence for CSPG4_MYO1D


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000318217_chr17_31082680_-_604aa
MQSGPRPPLPAPGLALALTLTMLARLASADXLLQQSDHCXPRGATAQRDHCNPXXCLHECRQSHRXNVSXSTXQXIGQTRPFFQPKALCL
RQNSGVXSRFSNSTLCRRCSLFCHWFYXQKXRYFISRFQAPYVXQFKSCAQEYVAXRQTEHYRGDQATSDCCYLVXEFYDCSSRQPCIKG
TILRSLHQTQXQEISTDIXXXTLPAPSRISWTTGKCESASGRICLPPDIREVSSQVXDDLXIHLAQPXPSFRQRGCQETNXTVWFSGXCS
LWEDQNFHSNTPNIVYLGRTPCPDAHKDCPLSTKGVAGHPGPHAVQKNQGSSDNNQVLPALQSEVVHPRGGQTLPWRQDHARLREAREVA
KPSXSSSPFXGGPADDFQXMESIPAHQEHSGLRPAPGQGKGCSRGNVEGSKGXPRAPEGLGGQLSCFKARYTSDLRHFCPCCXXIETEGQ
IHECPLFLSRPXGKSIXXGGRQSNFCHXPSPVXNGSHXTVQGDEDYPSIQFDWSECLQWKGPTCSVPYERQQRPHCLPLQQTANPXESNW

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000394649_chr17_31082680_-_604aa
MQSGPRPPLPAPGLALALTLTMLARLASADXLLQQSDHCXPRGATAQRDHCNPXXCLHECRQSHRXNVSXSTXQXIGQTRPFFQPKALCL
RQNSGVXSRFSNSTLCRRCSLFCHWFYXQKXRYFISRFQAPYVXQFKSCAQEYVAXRQTEHYRGDQATSDCCYLVXEFYDCSSRQPCIKG
TILRSLHQTQXQEISTDIXXXTLPAPSRISWTTGKCESASGRICLPPDIREVSSQVXDDLXIHLAQPXPSFRQRGCQETNXTVWFSGXCS
LWEDQNFHSNTPNIVYLGRTPCPDAHKDCPLSTKGVAGHPGPHAVQKNQGSSDNNQVLPALQSEVVHPRGGQTLPWRQDHARLREAREVA
KPSXSSSPFXGGPADDFQXMESIPAHQEHSGLRPAPGQGKGCSRGNVEGSKGXPRAPEGLGGQLSCFKARYTSDLRHFCPCCXXIETEGQ
IHECPLFLSRPXGKSIXXGGRQSNFCHXPSPVXNGSHXTVQGDEDYPSIQFDWSECLQWKGPTCSVPYERQQRPHCLPLQQTANPXESNW

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000579584_chr17_31082680_-_559aa
MQSGPRPPLPAPGLALALTLTMLARLASADXLLQQSDHCXPRGATAQRDHCNPXXCLHECRQSHRXNVSXSTXQXIGQTRPFFQPKALCL
RQNSGVXSRFSNSTLCRRCSLFCHWFYXQKXRYFISRFQAPYVXQFKSCAQEYVAXRQTEHYRGDQATSDCCYLVXEFYDCSSRQPCIKG
TILRSLHQTQXQEISTDIXXXTLPAPSRISWTTGKCESASGRICLPPDIREVSSQVXDDLXIHLAQPXPSFRQRGCQETNXTVWFSGXCS
LWEDQNFHSNTPNIVYLGRTPCPDAHKDCPLSTKGVAGHPGPHAVQKNQGSSDNNQVLPALQSEVVHPRGGQTLPWRQDHARLREAREVA
KPSXSSSPFXGGPADDFQXMESIPAHQEHSGLRPAPGQGKGCSRGNVEGSKGXPRAPEGLGGQLSCFKARYTSDLRHFCPCCXXIETEGQ
IHECPLFLSRPXGKSIXXGGRQSNFCHXPSPVXNGSHXTVQGDEDYPSIQFDWSECLQWKGPTCSVPYERQQRPHCLPLQQTANPXESNW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000318217_chr17_31082680_-_1813nt
ATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCGGAT
TGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAATGT
CGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGCCTC
AGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAAAAA
TAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACTGAG
CATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAAGGA
ACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATATCT
TGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGATCTC
TGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGTAGC
TTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGTCCT
CTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCGGCG
CTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTGGCC
AAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCATTCC
GGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGCCTG
GGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGACAA
ATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCGTCA
CCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGGAAA
GGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAATTGG
AGAACTTGTTGGAGTGCTGGTGAATCATTTCAAGAGTGAGAAGCGCCACCTTCAAGTGAACGTCACCAACCCAGTACAGTGCAGCCTGCA
CGGGAAGAAGTGCACCGTCTCCGTGGAGACGCGGCTCAACCAGCCCCAGCCCGACTTCACCAAGAATCGCTCGGGCTTCATCCTCAGCGT

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000394649_chr17_31082680_-_1813nt
ATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCGGAT
TGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAATGT
CGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGCCTC
AGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAAAAA
TAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACTGAG
CATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAAGGA
ACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATATCT
TGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGATCTC
TGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGTAGC
TTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGTCCT
CTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCGGCG
CTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTGGCC
AAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCATTCC
GGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGCCTG
GGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGACAA
ATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCGTCA
CCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGGAAA
GGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAATTGG
AGAACTTGTTGGAGTGCTGGTGAATCATTTCAAGAGTGAGAAGCGCCACCTTCAAGTGAACGTCACCAACCCAGTACAGTGCAGCCTGCA
CGGGAAGAAGTGCACCGTCTCCGTGGAGACGCGGCTCAACCAGCCCCAGCCCGACTTCACCAAGAATCGCTCGGGCTTCATCCTCAGCGT

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000579584_chr17_31082680_-_1678nt
ATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCGGAT
TGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAATGT
CGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGCCTC
AGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAAAAA
TAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACTGAG
CATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAAGGA
ACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATATCT
TGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGATCTC
TGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGTAGC
TTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGTCCT
CTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCGGCG
CTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTGGCC
AAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCATTCC
GGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGCCTG
GGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGACAA
ATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCGTCA
CCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGGAAA
GGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAATTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000318217_chr17_31082680_-_4143nt
GCGCCCAGGAGCAGAGCCGCGCTCGCTCCACTCAGCTCCCAGCTCCCAGGACTCCGCTGGCTCCTCGCAAGTCCTGCCGCCCAGCCCGCC
GGGATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCG
GATTGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAA
TGTCGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGC
CTCAGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAA
AAATAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACT
GAGCATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAA
GGAACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATA
TCTTGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGAT
CTCTGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGT
AGCTTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGT
CCTCTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCG
GCGCTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTG
GCCAAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCAT
TCCGGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGC
CTGGGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGA
CAAATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCG
TCACCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGG
AAAGGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAAT
TGGAGAACTTGTTGGAGTGCTGGTGAATCATTTCAAGAGTGAGAAGCGCCACCTTCAAGTGAACGTCACCAACCCAGTACAGTGCAGCCT
GCACGGGAAGAAGTGCACCGTCTCCGTGGAGACGCGGCTCAACCAGCCCCAGCCCGACTTCACCAAGAATCGCTCGGGCTTCATCCTCAG
CGTGCCCGGGAACTGACGCCCCGCGGAGGCCTGGCCCGGAGCCCGGCCACACTCCGAGTCCTGGGTCCCAGTCCAGCTGCTGCCTCCCAA
CCCATGCCCGCTAGAAACCTGCTGCGAGGGCCCCTCCCAGAGGAGCCCCGCCCCTGTAAGATTTCCTTCCTGGTTTTCTGCCTTTGGTAT
CATCTTCCTCTGTCCTTACTGTCCACGGTCCCTGTTCAATAAGCCAAAGACCCTGGTGCCCCGCCCAGACCCCTGGGCTGACGTCCAGAC
CAATCTCACCCCAGAGGCAACTGGATGGTGCCTTTAGTTGGTGCGGATGCCCCGTGGCCAGGTCAAGTCAGAGCACCTGGACAGGTGTCC
TCCCTGCTGCTGACCCTGCAGAGGGAAGGGGTGGGGATGCAGGACCCCACTCTGCGGGAGCCCCATAGCCACCTCTCTTGCCCAAGGTGA
GCCAGCCCTGGGGACCCAGCTCAGGGAGGCTCTGCTCAGAGTTCGGCGGACCCACCCCAACCCAACTCCCAGCCGCCAGCCAAAGCCACT
GGGTGAGCAGAGTCACCCACAGGGCCAGCCCCTCAGCCAGGAGCCAGTGGCAGGAGCGGAACAGCCCATCCAGCAGAGTGAGTCCATCCT
TCCCAGGTTCTCCCCTGGGAGACTCCCTTTGCCACCAAGGCCCCCACCAGGGCCTCTGACCACCGCTCTGGAGAGGACAGTGTGGCATGC
TCCAAGGATCATCTTACTTAACTCGCAGCCTGTGGCTGTGGTCCTCTTATAGATACTTTCACCGTTTGCAGGGTTGCTAATCAGATACCT
GCTGTCACCACACTTGGGTCAGGAACCCTAATGAGAACGGGGAGCTGCCAGGGTGAGGGCAGCCCTCAGGGTCGGCCGCTTTCCCTCTGG
ACCACCTCCCGCTGCGTTTCCTACTCAGAGAAACAGCAAGGGCGGGGTCAAGACACGGGATGACGGGAAGCAGGAAGCGGGGCAGCAGCA
CAGCGTGGGGTCCTGGCACTGCAGGCCAGGCCAGGATGCCCACCCCGCCCTCTACACGGCCCCTTGGGGCCTGCGCCCGTGAAACTGGTG
CCAGGGAGCACTGCCAGCTTGCCAGTTTCTGCCCAGCAAAAGCACGTATGCTTCAGGGGCCTTCTGAGACCACCTTCCCCACTGAGCCCC
AGCTGCTGAGAAGGCCTTGAGGGAAGTAGAGGCTGGGAGCAAATGCCCCATGCGGTGAGAGGATGAGGGGAGCCTACGCCTCAGGCATGT
GGTGAGAGGATGAGGGGGAGGGAGCCAACGCCTCAGGTGGAGTGGGCAGAGGTGCAAGAGAGGGATGTACTGAAGCTTCTTCCCGTCCTG
CCACAGACACTTCTCCTGCCTTCCCACCCTGACCCGGCAGAACCCACCAAGTGCCTGTGTGCAGCCTCCTGTGCCTCACCCAGGGCCTGA
CCCCAGAGTGGTCCCAACAACCCGGTCTCATGCCCACTCCCCATCCCTGCTTCCCAAAAATTGCACTGTGTGCAGTTTGCAACAAAGAAT
CCCGCTGGCATCCTGTCCTTGGGAACCCTTTCTCATTCTCCAAGCCTGGTCAGCTGCCTGCACAGGCAGAGGTGCCCTCAGCCCAGATTA
GCAACACTCATAGTTTTGCCAATTACCAGTAGACACTAGTGGAACCATCTAACTGGAACTTCCTCTCTCCTTCCACTTATTTCCTCAAAC
TTGTTGCTTTACACTAGACACATGCAAATGTATGTTTTAAACACACCAAAACAGATCATGCCAAATGAGTTGCCTGTCAAAGGCTGGAGG
GCAGGAGGAGGGCCTGGGTTTGGGTTCTTTCCTCCCAGCCTTTGGATGGTGCCTTGGGCCCCTTAGCCCCAGCGCCAGGGCCTCCCAGCT
GAGGCCACAGGACAAGCACTTTTTTATGATGTACTAAAAGCCACAGTATGTGGCAACTGCAAAAGGATCAGGAATTTAGGGTATGATCTC
GGTCACGTGTCCCGGGCGCTGAGGGGAAAGGAAGCGGGCATGATTGTAGACAATGAGGGGGTTCTCTTGATGTAATGAAATGCAATTTTA
TGGTTTGGTGCAAAAACTCCTATTTTCCAGTAAATTAACTTTATTTCTAAAGCATATTTTGATTTGCCATCAAGAGCAATAAAGCATTAA
ATCTTATTTTTAAAGGTGTTCTGCTTATCTGTCACTGAAAACTTGGTGAAATTTTTGCTTAAATAAAGTCAACCATTATCTGGGAGGATA

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000394649_chr17_31082680_-_4056nt
GCGCCCAGGAGCAGAGCCGCGCTCGCTCCACTCAGCTCCCAGCTCCCAGGACTCCGCTGGCTCCTCGCAAGTCCTGCCGCCCAGCCCGCC
GGGATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCG
GATTGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAA
TGTCGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGC
CTCAGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAA
AAATAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACT
GAGCATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAA
GGAACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATA
TCTTGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGAT
CTCTGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGT
AGCTTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGT
CCTCTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCG
GCGCTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTG
GCCAAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCAT
TCCGGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGC
CTGGGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGA
CAAATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCG
TCACCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGG
AAAGGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAAT
TGGAGAACTTGTTGGAGTGCTGGTGAATCATTTCAAGAGTGAGAAGCGCCACCTTCAAGTGAACGTCACCAACCCAGTACAGTGCAGCCT
GCACGGGAAGAAGTGCACCGTCTCCGTGGAGACGCGGCTCAACCAGCCCCAGCCCGACTTCACCAAGAATCGCTCGGGCTTCATCCTCAG
CGTGCCCGGGAACTGACGCCCCGCGGAGGCCTGGCCCGGAGCCCGGCCACACTCCGAGTCCTGGGTCCCAGTCCAGCTGCTGCCTCCCAA
CCCATGCCCGCTAGAAACCTGCTGCGAGGGCCCCTCCCAGAGGAGCCCCGCCCCTGTAAGATTTCCTTCCTGGTTTTCTGCCTTTGGTAT
CATCTTCCTCTGTCCTTACTGTCCACGGTCCCTGTTCAATAAGCCAAAGACCCTGGTGCCCCGCCCAGACCCCTGGGCTGACGTCCAGAC
CAATCTCACCCCAGAGGCAACTGGATGGTGCCTTTAGTTGGTGCGGATGCCCCGTGGCCAGGTCAAGTCAGAGCACCTGGACAGGTGTCC
TCCCTGCTGCTGACCCTGCAGAGGGAAGGGGTGGGGATGCAGGACCCCACTCTGCGGGAGCCCCATAGCCACCTCTCTTGCCCAAGGTGA
GCCAGCCCTGGGGACCCAGCTCAGGGAGGCTCTGCTCAGAGTTCGGCGGACCCACCCCAACCCAACTCCCAGCCGCCAGCCAAAGCCACT
GGGTGAGCAGAGTCACCCACAGGGCCAGCCCCTCAGCCAGGAGCCAGTGGCAGGAGCGGAACAGCCCATCCAGCAGAGTGAGTCCATCCT
TCCCAGGTTCTCCCCTGGGAGACTCCCTTTGCCACCAAGGCCCCCACCAGGGCCTCTGACCACCGCTCTGGAGAGGACAGTGTGGCATGC
TCCAAGGATCATCTTACTTAACTCGCAGCCTGTGGCTGTGGTCCTCTTATAGATACTTTCACCGTTTGCAGGGTTGCTAATCAGATACCT
GCTGTCACCACACTTGGGTCAGGAACCCTAATGAGAACGGGGAGCTGCCAGGGTGAGGGCAGCCCTCAGGGTCGGCCGCTTTCCCTCTGG
ACCACCTCCCGCTGCGTTTCCTACTCAGAGAAACAGCAAGGGCGGGGTCAAGACACGGGATGACGGGAAGCAGGAAGCGGGGCAGCAGCA
CAGCGTGGGGTCCTGGCACTGCAGGCCAGGCCAGGATGCCCACCCCGCCCTCTACACGGCCCCTTGGGGCCTGCGCCCGTGAAACTGGTG
CCAGGGAGCACTGCCAGCTTGCCAGTTTCTGCCCAGCAAAAGCACGTATGCTTCAGGGGCCTTCTGAGACCACCTTCCCCACTGAGCCCC
AGCTGCTGAGAAGGCCTTGAGGGAAGTAGAGGCTGGGAGCAAATGCCCCATGCGGTGAGAGGATGAGGGGAGCCTACGCCTCAGGCATGT
GGTGAGAGGATGAGGGGGAGGGAGCCAACGCCTCAGGTGGAGTGGGCAGAGGTGCAAGAGAGGGATGTACTGAAGCTTCTTCCCGTCCTG
CCACAGACACTTCTCCTGCCTTCCCACCCTGACCCGGCAGAACCCACCAAGTGCCTGTGTGCAGCCTCCTGTGCCTCACCCAGGGCCTGA
CCCCAGAGTGGTCCCAACAACCCGGTCTCATGCCCACTCCCCATCCCTGCTTCCCAAAAATTGCACTGTGTGCAGTTTGCAACAAAGAAT
CCCGCTGGCATCCTGTCCTTGGGAACCCTTTCTCATTCTCCAAGCCTGGTCAGCTGCCTGCACAGGCAGAGGTGCCCTCAGCCCAGATTA
GCAACACTCATAGTTTTGCCAATTACCAGTAGACACTAGTGGAACCATCTAACTGGAACTTCCTCTCTCCTTCCACTTATTTCCTCAAAC
TTGTTGCTTTACACTAGACACATGCAAATGTATGTTTTAAACACACCAAAACAGATCATGCCAAATGAGTTGCCTGTCAAAGGCTGGAGG
GCAGGAGGAGGGCCTGGGTTTGGGTTCTTTCCTCCCAGCCTTTGGATGGTGCCTTGGGCCCCTTAGCCCCAGCGCCAGGGCCTCCCAGCT
GAGGCCACAGGACAAGCACTTTTTTATGATGTACTAAAAGCCACAGTATGTGGCAACTGCAAAAGGATCAGGAATTTAGGGTATGATCTC
GGTCACGTGTCCCGGGCGCTGAGGGGAAAGGAAGCGGGCATGATTGTAGACAATGAGGGGGTTCTCTTGATGTAATGAAATGCAATTTTA
TGGTTTGGTGCAAAAACTCCTATTTTCCAGTAAATTAACTTTATTTCTAAAGCATATTTTGATTTGCCATCAAGAGCAATAAAGCATTAA

>In-frame_CSPG4_ENST00000308508_chr15_76005009_-_MYO1D_ENST00000579584_chr17_31082680_-_2113nt
GCGCCCAGGAGCAGAGCCGCGCTCGCTCCACTCAGCTCCCAGCTCCCAGGACTCCGCTGGCTCCTCGCAAGTCCTGCCGCCCAGCCCGCC
GGGATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTGACTATGTTGGCCAGACTTGCATCCGCG
GATTGACTACTTCAACAATCAGATCATTGTTGACCTCGTGGAGCAACAGCACAAAGGGATCATTGCAATCCTTGATGATGCTTGCATGAA
TGTCGGCAAAGTCACCGATGAAATGTTTCTTGAAGCACTTAACAGTAAATTGGGCAAACACGCCCATTTTTCCAGCCGAAAGCTCTGTGC
CTCAGACAAAATTCTGGAGTTTGATCGAGATTTTCGAATTCGACATTATGCAGGCGATGTAGTCTATTCTGTCATTGGTTTTATTGACAA
AAATAAAGATACTTTATTTCAAGATTTCAAGCGCCTTATGTATAACAGTTCAAATCCTGTGCTCAAGAATATGTGGCCTGAAGGCAAACT
GAGCATTACAGAGGTGACCAAGCGACCTCTGACTGCTGCTACCTTGTTTAAGAATTCTATGATTGCTCTAGTAGACAACCTTGCATCAAA
GGAACCATATTACGTTCGTTGCATCAAACCCAATGACAAGAAATCTCCACAGATATTTGATGATGAACGCTGCCGGCACCAAGTAGAATA
TCTTGGACTACTGGAAAATGTGAGAGTGCGTCGGGCAGGATTTGCCTTCCGCCAGACATACGAGAAGTTTCTTCACAGGTATAAGATGAT
CTCTGAATTCACCTGGCCCAACCATGACCTTCCTTCAGACAAAGAGGCTGTCAAGAAACTAATTGAACGGTGTGGTTTTCAGGATGATGT
AGCTTATGGGAAGACCAAAATTTTCATTCGAACACCCCGAACATTGTTTACCTTGGAAGAACTCCGTGCCCAGATGCTCATAAGGATTGT
CCTCTTTCTACAAAAGGTGTGGCGGGGCACCCTGGCCCGCATGCGGTACAAAAGAACCAAGGCAGCTCTGACAATAATCAGGTACTACCG
GCGCTACAAAGTGAAGTCGTACATCCACGAGGTGGCCAGACGCTTCCATGGCGTCAAGACCATGCGAGACTACGGGAAGCACGTGAAGTG
GCCAAGCCCTCCTAAAGTTCTTCGCCGTTTTGAGGAGGCCCTGCAGACGATTTTCAATAGATGGAGAGCATCCCAGCTCATCAAGAGCAT
TCCGGCCTCAGACCTGCCCCAGGTCAGGGCAAAGGTTGCAGCCGTGGAAATGTTGAAGGGTCAAAGGGCTGACCTCGGGCTCCAGAGGGC
CTGGGAGGGCAACTATCTTGCTTCAAAGCCAGATACACCTCAGACCTCAGGCACTTTTGTCCCTGTTGCTAATGAATTGAAACGGAAGGA
CAAATACATGAATGTCCTCTTTTCCTGTCACGTCCGTAAGGTAAATCGATTTAGTAAGGTGGAAGACAGAGCAATTTTTGTCACTGACCG
TCACCTGTATAAAATGGATCCCACTAAACAGTACAAGGTGATGAAGACTATCCCTCTATACAATTTGACTGGTCTGAGTGTCTCCAATGG
AAAGGACCAACTTGTAGTGTTCCATACGAAAGACAACAAAGACCTCATTGTCTGCCTCTTCAGCAAACAGCCAACCCATGAGAGTCGAAT
TGGAGAACTTGTTGGAGTGCTGGTGAATCATTTCAAGAGAAACCATCTGCTTATACTCTGAATAAAATTCAAGAAAGCATAGATTCTACA
TAAACAGGCCCAAGATTACATGGCAAACTGAGATGAAGAGGATGCTGGCTGAGAAACAAACAAAAGTGTTCAATTATTTGAATGAAGTAA
GGAAAGATATTTTAAAATGTAAATCAACATTAAAATCTGAAAATGGCACAGTTGATATTGCAGAAAATAGAATTGATGTGAAAGGAAAGT
TTGAAGTCTCTCAGTGTGCAGAATTTACTGTTATAATGGGCAACATGTTAACTTTCTTAGCAATATACAAAATAAGGGTACATCTTACAG


Top

FusionGenePPI for CSPG4_MYO1D


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CSPG4GRIP2, CDC42, GRIP1, CAPNS1, LGALS3, LGALS8, LGALS9, PCBP4, SORT1, ZNF644MYO1DILK, PELO, SIRT7, FBXO25, CUL1, LRRK2, UBASH3B, SHC1, ATP6V1B1, ECT2, MDC1, PAXIP1, PAN2, CCDC8, EGFR, DAPK1, PEX19, VSIG4, UBB, TBC1D9B, PTEN, ZNF746, SSH1, SSH2, PSMC4, DKK3, FBXO40, TOR1AIP2, BTD, HAVCR2, EID1, NEXN, SCN3B, SSSCA1, CDH5, DNAI2, PPP6R2, LSP1, BBS7, COX15, DLST, PDHA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110631_1446292323COL5A1
HgeneCSPG4chr15:76005009chr17:31082680ENST00000308508-110574_1040292323COL6A2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CSPG4_MYO1D


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CSPG4_MYO1D


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMYO1DC0004352Autistic Disorder1CTD_human