FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 843

FusionGeneSummary for ADCY9_GLYR1

check button Fusion gene summary
Fusion gene informationFusion gene name: ADCY9_GLYR1
Fusion gene ID: 843
HgeneTgene
Gene symbol

ADCY9

GLYR1

Gene ID

115

84656

Gene nameadenylate cyclase 9glyoxylate reductase 1 homolog
SynonymsAC9|ACIXBM045|HIBDL|N-PAC|NP60
Cytomap

16p13.3

16p13.3

Type of geneprotein-codingprotein-coding
Descriptionadenylate cyclase type 9ATP pyrophosphate-lyase 9adenylate cyclase type IXadenylyl cyclase 9type IX ATP pyrophosphate-lyaseputative oxidoreductase GLYR13-hydroxyisobutyrate dehydrogenase-like proteincytokine-like nuclear factor n-pacnuclear protein 60 kDanuclear protein 60kDanuclear protein NP60nuclear protein of 60 kDa
Modification date2018052220180523
UniProtAcc

O60503

Q49A26

Ensembl transtripts involved in fusion geneENST00000294016, ENST00000571889, 
ENST00000436648, ENST00000321919, 
ENST00000381983, ENST00000591451, 
ENST00000586901, 
Fusion gene scores* DoF score18 X 5 X 10=9005 X 3 X 3=45
# samples 175
** MAII scorelog2(17/900*10)=-2.40439025507934
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/45*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ADCY9 [Title/Abstract] AND GLYR1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneADCY9

GO:0006171

cAMP biosynthetic process

9628827|10987815

HgeneADCY9

GO:0007189

adenylate cyclase-activating G-protein coupled receptor signaling pathway

9628827


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A1RH-01AADCY9chr16

4038995

-GLYR1chr16

4862249

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000294016ENST00000436648ADCY9chr16

4038995

-GLYR1chr16

4862249

-
In-frameENST00000294016ENST00000321919ADCY9chr16

4038995

-GLYR1chr16

4862249

-
In-frameENST00000294016ENST00000381983ADCY9chr16

4038995

-GLYR1chr16

4862249

-
In-frameENST00000294016ENST00000591451ADCY9chr16

4038995

-GLYR1chr16

4862249

-
5CDS-intronENST00000294016ENST00000586901ADCY9chr16

4038995

-GLYR1chr16

4862249

-
intron-3CDSENST00000571889ENST00000436648ADCY9chr16

4038995

-GLYR1chr16

4862249

-
intron-3CDSENST00000571889ENST00000321919ADCY9chr16

4038995

-GLYR1chr16

4862249

-
intron-3CDSENST00000571889ENST00000381983ADCY9chr16

4038995

-GLYR1chr16

4862249

-
intron-3CDSENST00000571889ENST00000591451ADCY9chr16

4038995

-GLYR1chr16

4862249

-
intron-intronENST00000571889ENST00000586901ADCY9chr16

4038995

-GLYR1chr16

4862249

-

Top

FusionProtFeatures for ADCY9_GLYR1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ADCY9

O60503

GLYR1

Q49A26


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611394_5217701354DomainGuanylate cyclase 1
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611399_4047701354Nucleotide bindingATP
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611441_4437701354Nucleotide bindingATP
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611139_1417701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611163_1717701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611193_2157701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-6111_1177701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611236_2417701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611260_2807701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611118_1387701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611142_1627701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611172_1927701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611216_2357701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611242_2597701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611281_3017701354TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-6111058_11987701354DomainGuanylate cyclase 2
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-6111185_11877701354Nucleotide bindingATP
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-6111192_11967701354Nucleotide bindingATP
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611302_7867701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611808_8187701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611840_8677701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611889_8917701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611913_9207701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611942_9757701354Topological domainExtracellular
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611997_13537701354Topological domainCytoplasmic
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611787_8077701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611819_8397701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611868_8887701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611892_9127701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611921_9417701354TransmembraneHelical
HgeneADCY9chr16:4038995chr16:4862249ENST00000294016-611976_9967701354TransmembraneHelical
TgeneGLYR1chr16:4038995chr16:4862249ENST00000321919-1116168_180373554DNA bindingA.T hook
TgeneGLYR1chr16:4038995chr16:4862249ENST00000381983-1015168_180356537DNA bindingA.T hook
TgeneGLYR1chr16:4038995chr16:4862249ENST00000436648-1015168_180292473DNA bindingA.T hook
TgeneGLYR1chr16:4038995chr16:4862249ENST00000591451-1116168_180367548DNA bindingA.T hook
TgeneGLYR1chr16:4038995chr16:4862249ENST00000321919-11168_66373554DomainPWWP
TgeneGLYR1chr16:4038995chr16:4862249ENST00000381983-10158_66356537DomainPWWP
TgeneGLYR1chr16:4038995chr16:4862249ENST00000436648-10158_66292473DomainPWWP
TgeneGLYR1chr16:4038995chr16:4862249ENST00000591451-11168_66367548DomainPWWP
TgeneGLYR1chr16:4038995chr16:4862249ENST00000321919-1116271_285373554Nucleotide bindingNAD
TgeneGLYR1chr16:4038995chr16:4862249ENST00000381983-1015271_285356537Nucleotide bindingNAD
TgeneGLYR1chr16:4038995chr16:4862249ENST00000436648-1015271_285292473Nucleotide bindingNAD
TgeneGLYR1chr16:4038995chr16:4862249ENST00000591451-1116271_285367548Nucleotide bindingNAD


Top

FusionGeneSequence for ADCY9_GLYR1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000436648_chr16_4862249_-_951aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGGGRLRRQKKLPQLFERASSRW
WDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFP
SPGAGALHWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAG
CPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDC
SSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYI

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000321919_chr16_4862249_-_951aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGGGRLRRQKKLPQLFERASSRW
WDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFP
SPGAGALHWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAG
CPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDC
SSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYI

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000381983_chr16_4862249_-_951aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGGGRLRRQKKLPQLFERASSRW
WDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFP
SPGAGALHWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAG
CPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDC
SSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYI

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000591451_chr16_4862249_-_951aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGGGRLRRQKKLPQLFERASSRW
WDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFP
SPGAGALHWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAG
CPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDC
SSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000436648_chr16_4862249_-_2853nt
ATGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTC
AAGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCC
GGGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGG
TGGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTC
TTCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTG
TGCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACC
CTGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACA
GCCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTA
CCTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCC
TCGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTC
ATGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAA
GAGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGG
CATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATC
GAAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAAC
GATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGC
TGTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAG
AAGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGG
TCCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGAT
GACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTG
ATATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCC
TCAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGC
CCTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAAC
AGCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACT
TCTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATC
CGGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTC
AGCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTG
GAAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGC
AGCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTC
CAAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAAT
CAGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATT
CAGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000321919_chr16_4862249_-_2853nt
ATGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTC
AAGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCC
GGGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGG
TGGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTC
TTCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTG
TGCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACC
CTGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACA
GCCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTA
CCTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCC
TCGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTC
ATGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAA
GAGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGG
CATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATC
GAAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAAC
GATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGC
TGTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAG
AAGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGG
TCCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGAT
GACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTG
ATATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCC
TCAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGC
CCTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAAC
AGCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACT
TCTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATC
CGGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTC
AGCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTG
GAAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGC
AGCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTC
CAAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAAT
CAGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATT
CAGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000381983_chr16_4862249_-_2853nt
ATGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTC
AAGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCC
GGGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGG
TGGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTC
TTCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTG
TGCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACC
CTGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACA
GCCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTA
CCTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCC
TCGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTC
ATGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAA
GAGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGG
CATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATC
GAAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAAC
GATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGC
TGTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAG
AAGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGG
TCCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGAT
GACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTG
ATATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCC
TCAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGC
CCTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAAC
AGCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACT
TCTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATC
CGGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTC
AGCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTG
GAAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGC
AGCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTC
CAAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAAT
CAGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATT
CAGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000591451_chr16_4862249_-_2853nt
ATGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTC
AAGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCC
GGGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGG
TGGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTC
TTCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTG
TGCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACC
CTGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACA
GCCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTA
CCTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCC
TCGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTC
ATGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAA
GAGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGG
CATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATC
GAAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAAC
GATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGC
TGTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAG
AAGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGG
TCCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGAT
GACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTG
ATATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCC
TCAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGC
CCTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAAC
AGCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACT
TCTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATC
CGGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTC
AGCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTG
GAAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGC
AGCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTC
CAAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAAT
CAGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATT
CAGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000436648_chr16_4862249_-_5425nt
GCGGCCGCGGCGGGAGCGGCGGCGCACTCGGGGGGAAGCAGGCCCCACTAGACGGGCCGCGCCGACGGGCTCCGCGCACTCGCAGCCCGG
GGCGCCCCCACCCCCAGCGCCCGCCGCCGCGGGCAGGGCCGGCCCGGAGCGCGGGGGGCGGCCGGGGAGCGCGAGCCGGGGGCGCCCGCC
GAAGCTCGCTGCTCCGGGTCGGGGTCCGGGCCCGGGGCCGGCCGCGCGCCGCCTTTGACGCATCGGAGCGCGGCTCCTGCAGGATGGAGG
GCTCCGCGCCGCCAGCGGAGTTGTTTGTGCGCAGGCGGCTCGCGGGGCTGGGAGCGCTCAAGGTCTGAACTTCCCTCCGGAGCCGCAGCT
GGAGGAGGCGAGCGCGCGAGGAGGAGAAGCCGCGCGGCGCGGAGGCCACCCTCGGGGCGAGAGGCGCGGAAGGCGAGCGAGCAAAGCGGT
CCCGGAGCCACGGCGGCCACGCGGCGGGGACCCCCGGGCGTTCTAGGTACTGGTGACCCCGGCCGGGGCAGGCCCCGGGACTCGACAACA
TGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTCA
AGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCCG
GGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGGT
GGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTCT
TCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTGT
GCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACCC
TGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACAG
CCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTAC
CTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCCT
CGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTCA
TGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAAG
AGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGGC
ATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATCG
AAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAACG
ATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGCT
GTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAGA
AGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGGT
CCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGATG
ACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTGA
TATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCCT
CAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGCC
CTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAACA
GCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACTT
CTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATCC
GGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTCA
GCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTGG
AAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGCA
GCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTCC
AAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAATC
AGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATTC
AGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGAG
CCAAGGCGCTGGACCAGTCTGACAACGATATGTCCGCCGTGTACCGAGCCTACATACACTAAGCTGTCGACACCCCGCCCTCACCCCTCC
AATCCCCCCTCTGACCCCCTCTTCCTCACATGGGGTCGGGGGCCTGGGAGTTCATTCTGGACCAGCCCACCTATCTCCATTTCCTTTTAT
ACAGACTTTGAGACTTGCCATCAGCACAGCACACAGCAGCACCCTTCCCCTGAGGCCGGTGGGGAGGGGACAAGTGTCAGCAGGATTGGC
GTGTGGGAAAGCTCTTGAGCTGGGCACTGGCCCCCCGGACGAGGTGGCTGTGTGTTCACACACACACACACACACACACACACACACACA
CACAGGCTCTCGCCCCAGGATAGAAGCTGCCCAGAAACTGCTGCCTGGCTTTTTTTCTTCCGAGCTTGTCTTATCTCAAACCCCTTCCAG
TCAAGGAACTAGAATCAGCAACGAGAGTTGGAAGCCTTCCCACAGCTTCCCCCAGAGCGAAGAGGCTGTAGTCATGTCCCCATCCCCCAC
TGGATTCCCTACAAGGAGAGGCCTTGGGCCCAGATGAGCCAGTACAGACTCCAGACAGAGGGGCCCTTGGGGCCCTCCAACCTCAGGTGA
TGAGCTGAGAAAGATGTTCACGTCTAAGCGTCCAGTGTGCACCCAGCGCTCCATAGACGCCTTTGTGAACTGAAAAGAGACTGGCAGAGT
CCCGAGAAGATGGGGCCCTGGCTTTCCAGGGAGTGCAGCAAGCAGCCGGCCTGCAGGTGAGCATGGAGGCCCGGCCCTCACCGCCTCGAA
GCCATGCCCCAGATGCCACTGCCACAGCGGGCGCTCGCTCCTCCCTAGGCTGTTTTAGTATTTGGATTTGCATTCCATCCCTTGGGAGGG
AGTCCTCAGGGCCACTAGTGATGAGCCAAGAGGAGTGGGGGTTGGGGGCGCTCCTTTCTGTTTCCGTTAGGCCACAGACTCTTCACCTGG
CTCTGAAGAGCCACTCTTACCTCGGTCCCCTCCCAGTGGTCCCACCTTCTCCACCCTGCCCTGCCAAGTCCCCTGCATGCCCACCGCTCT
CCATCCTCCCTCCTCTCCCTCTTCCTCCCGTGGAGACAGTATTTCTTTCTGTCTGTCCCTTTGGCCCAGACCCAGCCTGACCAACGATGA
GCATTTCTTAGGCTCAGCTCTTGATACGGAAACGAGTGTCTTCACTCCAGCCAGCATCATGGTCTTCGGTGCTTCCCGGGCCCGGGGTCT
GTCGGGAGGGAAGAGAACTGGGCCTGACCTACCTGAACTGACTGGCCCTCCGAGGTGGGTCTGGGACATCCTAGAGGCCCTACATTTGTC
CTTGGATAGGGGACCGGGGGGGGCTTGGAATGTTGCAAAAAAAAAAGTTACCCAAGGGATGTCAGTTTTTTATCCCTCTGCATGGGTTGG
ATTTTCCAAAATCATAATTTGCAGAAGGAAGGCCAGCATTTACGATGCAATATGTAATTATATATAGGGTGGCCACACTAGGGCGGGGTC
CTTCCCCCCTCACAGCTTTGGCCCCTTTCAGAGATTAGAAACTGGGTTAGAGGATTGCAGAAGACGAGTGGGGGGAGGGCAGGGAAGATG
CCTGTCGGGTTTTTAGCACAGTTCATTTCACTGGGATTTTGAAGCATTTCTGTCTGAACACAAAGCCTGTTCTAGTCCTGGCGGAACACA
CTGGGGGTGGGGGCGGGGGAAGATGCGGTAATGAAACCGGTTAGTCAATTTTGTCTTAATATTGTTGACAATTCTGTAAAGTTCCTTTTT
ATGAATATTTCTGTTTAAGCTATTTCACCTTTCTTTTGAAATCCTTCCCTTTTAAGGAGAAAATGTGACACTTGTGAAAAAGCTTGTAAG
AAAGCCCCTCCCTTTTTTCTTTAAACCTTTAAATGACAAATCTAGGTAATTAAGGTTGTGAATTTTTATTTTTGCTTTGTTTTTAATGAA
CATTTGTCTTTCAGAATAGGATTGTGTGATAATGTTTAAATGGCAAAAACAAAACATGATTTTGTGCAATTAACAAAGCTACTGCAAGAA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000321919_chr16_4862249_-_5425nt
GCGGCCGCGGCGGGAGCGGCGGCGCACTCGGGGGGAAGCAGGCCCCACTAGACGGGCCGCGCCGACGGGCTCCGCGCACTCGCAGCCCGG
GGCGCCCCCACCCCCAGCGCCCGCCGCCGCGGGCAGGGCCGGCCCGGAGCGCGGGGGGCGGCCGGGGAGCGCGAGCCGGGGGCGCCCGCC
GAAGCTCGCTGCTCCGGGTCGGGGTCCGGGCCCGGGGCCGGCCGCGCGCCGCCTTTGACGCATCGGAGCGCGGCTCCTGCAGGATGGAGG
GCTCCGCGCCGCCAGCGGAGTTGTTTGTGCGCAGGCGGCTCGCGGGGCTGGGAGCGCTCAAGGTCTGAACTTCCCTCCGGAGCCGCAGCT
GGAGGAGGCGAGCGCGCGAGGAGGAGAAGCCGCGCGGCGCGGAGGCCACCCTCGGGGCGAGAGGCGCGGAAGGCGAGCGAGCAAAGCGGT
CCCGGAGCCACGGCGGCCACGCGGCGGGGACCCCCGGGCGTTCTAGGTACTGGTGACCCCGGCCGGGGCAGGCCCCGGGACTCGACAACA
TGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTCA
AGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCCG
GGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGGT
GGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTCT
TCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTGT
GCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACCC
TGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACAG
CCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTAC
CTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCCT
CGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTCA
TGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAAG
AGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGGC
ATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATCG
AAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAACG
ATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGCT
GTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAGA
AGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGGT
CCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGATG
ACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTGA
TATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCCT
CAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGCC
CTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAACA
GCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACTT
CTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATCC
GGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTCA
GCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTGG
AAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGCA
GCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTCC
AAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAATC
AGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATTC
AGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGAG
CCAAGGCGCTGGACCAGTCTGACAACGATATGTCCGCCGTGTACCGAGCCTACATACACTAAGCTGTCGACACCCCGCCCTCACCCCTCC
AATCCCCCCTCTGACCCCCTCTTCCTCACATGGGGTCGGGGGCCTGGGAGTTCATTCTGGACCAGCCCACCTATCTCCATTTCCTTTTAT
ACAGACTTTGAGACTTGCCATCAGCACAGCACACAGCAGCACCCTTCCCCTGAGGCCGGTGGGGAGGGGACAAGTGTCAGCAGGATTGGC
GTGTGGGAAAGCTCTTGAGCTGGGCACTGGCCCCCCGGACGAGGTGGCTGTGTGTTCACACACACACACACACACACACACACACACACA
CACAGGCTCTCGCCCCAGGATAGAAGCTGCCCAGAAACTGCTGCCTGGCTTTTTTTCTTCCGAGCTTGTCTTATCTCAAACCCCTTCCAG
TCAAGGAACTAGAATCAGCAACGAGAGTTGGAAGCCTTCCCACAGCTTCCCCCAGAGCGAAGAGGCTGTAGTCATGTCCCCATCCCCCAC
TGGATTCCCTACAAGGAGAGGCCTTGGGCCCAGATGAGCCAGTACAGACTCCAGACAGAGGGGCCCTTGGGGCCCTCCAACCTCAGGTGA
TGAGCTGAGAAAGATGTTCACGTCTAAGCGTCCAGTGTGCACCCAGCGCTCCATAGACGCCTTTGTGAACTGAAAAGAGACTGGCAGAGT
CCCGAGAAGATGGGGCCCTGGCTTTCCAGGGAGTGCAGCAAGCAGCCGGCCTGCAGGTGAGCATGGAGGCCCGGCCCTCACCGCCTCGAA
GCCATGCCCCAGATGCCACTGCCACAGCGGGCGCTCGCTCCTCCCTAGGCTGTTTTAGTATTTGGATTTGCATTCCATCCCTTGGGAGGG
AGTCCTCAGGGCCACTAGTGATGAGCCAAGAGGAGTGGGGGTTGGGGGCGCTCCTTTCTGTTTCCGTTAGGCCACAGACTCTTCACCTGG
CTCTGAAGAGCCACTCTTACCTCGGTCCCCTCCCAGTGGTCCCACCTTCTCCACCCTGCCCTGCCAAGTCCCCTGCATGCCCACCGCTCT
CCATCCTCCCTCCTCTCCCTCTTCCTCCCGTGGAGACAGTATTTCTTTCTGTCTGTCCCTTTGGCCCAGACCCAGCCTGACCAACGATGA
GCATTTCTTAGGCTCAGCTCTTGATACGGAAACGAGTGTCTTCACTCCAGCCAGCATCATGGTCTTCGGTGCTTCCCGGGCCCGGGGTCT
GTCGGGAGGGAAGAGAACTGGGCCTGACCTACCTGAACTGACTGGCCCTCCGAGGTGGGTCTGGGACATCCTAGAGGCCCTACATTTGTC
CTTGGATAGGGGACCGGGGGGGGCTTGGAATGTTGCAAAAAAAAAAGTTACCCAAGGGATGTCAGTTTTTTATCCCTCTGCATGGGTTGG
ATTTTCCAAAATCATAATTTGCAGAAGGAAGGCCAGCATTTACGATGCAATATGTAATTATATATAGGGTGGCCACACTAGGGCGGGGTC
CTTCCCCCCTCACAGCTTTGGCCCCTTTCAGAGATTAGAAACTGGGTTAGAGGATTGCAGAAGACGAGTGGGGGGAGGGCAGGGAAGATG
CCTGTCGGGTTTTTAGCACAGTTCATTTCACTGGGATTTTGAAGCATTTCTGTCTGAACACAAAGCCTGTTCTAGTCCTGGCGGAACACA
CTGGGGGTGGGGGCGGGGGAAGATGCGGTAATGAAACCGGTTAGTCAATTTTGTCTTAATATTGTTGACAATTCTGTAAAGTTCCTTTTT
ATGAATATTTCTGTTTAAGCTATTTCACCTTTCTTTTGAAATCCTTCCCTTTTAAGGAGAAAATGTGACACTTGTGAAAAAGCTTGTAAG
AAAGCCCCTCCCTTTTTTCTTTAAACCTTTAAATGACAAATCTAGGTAATTAAGGTTGTGAATTTTTATTTTTGCTTTGTTTTTAATGAA
CATTTGTCTTTCAGAATAGGATTGTGTGATAATGTTTAAATGGCAAAAACAAAACATGATTTTGTGCAATTAACAAAGCTACTGCAAGAA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000381983_chr16_4862249_-_5422nt
GCGGCCGCGGCGGGAGCGGCGGCGCACTCGGGGGGAAGCAGGCCCCACTAGACGGGCCGCGCCGACGGGCTCCGCGCACTCGCAGCCCGG
GGCGCCCCCACCCCCAGCGCCCGCCGCCGCGGGCAGGGCCGGCCCGGAGCGCGGGGGGCGGCCGGGGAGCGCGAGCCGGGGGCGCCCGCC
GAAGCTCGCTGCTCCGGGTCGGGGTCCGGGCCCGGGGCCGGCCGCGCGCCGCCTTTGACGCATCGGAGCGCGGCTCCTGCAGGATGGAGG
GCTCCGCGCCGCCAGCGGAGTTGTTTGTGCGCAGGCGGCTCGCGGGGCTGGGAGCGCTCAAGGTCTGAACTTCCCTCCGGAGCCGCAGCT
GGAGGAGGCGAGCGCGCGAGGAGGAGAAGCCGCGCGGCGCGGAGGCCACCCTCGGGGCGAGAGGCGCGGAAGGCGAGCGAGCAAAGCGGT
CCCGGAGCCACGGCGGCCACGCGGCGGGGACCCCCGGGCGTTCTAGGTACTGGTGACCCCGGCCGGGGCAGGCCCCGGGACTCGACAACA
TGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTCA
AGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCCG
GGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGGT
GGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTCT
TCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTGT
GCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACCC
TGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACAG
CCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTAC
CTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCCT
CGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTCA
TGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAAG
AGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGGC
ATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATCG
AAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAACG
ATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGCT
GTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAGA
AGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGGT
CCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGATG
ACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTGA
TATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCCT
CAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGCC
CTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAACA
GCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACTT
CTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATCC
GGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTCA
GCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTGG
AAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGCA
GCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTCC
AAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAATC
AGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATTC
AGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGAG
CCAAGGCGCTGGACCAGTCTGACAACGATATGTCCGCCGTGTACCGAGCCTACATACACTAAGCTGTCGACACCCCGCCCTCACCCCTCC
AATCCCCCCTCTGACCCCCTCTTCCTCACATGGGGTCGGGGGCCTGGGAGTTCATTCTGGACCAGCCCACCTATCTCCATTTCCTTTTAT
ACAGACTTTGAGACTTGCCATCAGCACAGCACACAGCAGCACCCTTCCCCTGAGGCCGGTGGGGAGGGGACAAGTGTCAGCAGGATTGGC
GTGTGGGAAAGCTCTTGAGCTGGGCACTGGCCCCCCGGACGAGGTGGCTGTGTGTTCACACACACACACACACACACACACACACACACA
CACAGGCTCTCGCCCCAGGATAGAAGCTGCCCAGAAACTGCTGCCTGGCTTTTTTTCTTCCGAGCTTGTCTTATCTCAAACCCCTTCCAG
TCAAGGAACTAGAATCAGCAACGAGAGTTGGAAGCCTTCCCACAGCTTCCCCCAGAGCGAAGAGGCTGTAGTCATGTCCCCATCCCCCAC
TGGATTCCCTACAAGGAGAGGCCTTGGGCCCAGATGAGCCAGTACAGACTCCAGACAGAGGGGCCCTTGGGGCCCTCCAACCTCAGGTGA
TGAGCTGAGAAAGATGTTCACGTCTAAGCGTCCAGTGTGCACCCAGCGCTCCATAGACGCCTTTGTGAACTGAAAAGAGACTGGCAGAGT
CCCGAGAAGATGGGGCCCTGGCTTTCCAGGGAGTGCAGCAAGCAGCCGGCCTGCAGGTGAGCATGGAGGCCCGGCCCTCACCGCCTCGAA
GCCATGCCCCAGATGCCACTGCCACAGCGGGCGCTCGCTCCTCCCTAGGCTGTTTTAGTATTTGGATTTGCATTCCATCCCTTGGGAGGG
AGTCCTCAGGGCCACTAGTGATGAGCCAAGAGGAGTGGGGGTTGGGGGCGCTCCTTTCTGTTTCCGTTAGGCCACAGACTCTTCACCTGG
CTCTGAAGAGCCACTCTTACCTCGGTCCCCTCCCAGTGGTCCCACCTTCTCCACCCTGCCCTGCCAAGTCCCCTGCATGCCCACCGCTCT
CCATCCTCCCTCCTCTCCCTCTTCCTCCCGTGGAGACAGTATTTCTTTCTGTCTGTCCCTTTGGCCCAGACCCAGCCTGACCAACGATGA
GCATTTCTTAGGCTCAGCTCTTGATACGGAAACGAGTGTCTTCACTCCAGCCAGCATCATGGTCTTCGGTGCTTCCCGGGCCCGGGGTCT
GTCGGGAGGGAAGAGAACTGGGCCTGACCTACCTGAACTGACTGGCCCTCCGAGGTGGGTCTGGGACATCCTAGAGGCCCTACATTTGTC
CTTGGATAGGGGACCGGGGGGGGCTTGGAATGTTGCAAAAAAAAAAGTTACCCAAGGGATGTCAGTTTTTTATCCCTCTGCATGGGTTGG
ATTTTCCAAAATCATAATTTGCAGAAGGAAGGCCAGCATTTACGATGCAATATGTAATTATATATAGGGTGGCCACACTAGGGCGGGGTC
CTTCCCCCCTCACAGCTTTGGCCCCTTTCAGAGATTAGAAACTGGGTTAGAGGATTGCAGAAGACGAGTGGGGGGAGGGCAGGGAAGATG
CCTGTCGGGTTTTTAGCACAGTTCATTTCACTGGGATTTTGAAGCATTTCTGTCTGAACACAAAGCCTGTTCTAGTCCTGGCGGAACACA
CTGGGGGTGGGGGCGGGGGAAGATGCGGTAATGAAACCGGTTAGTCAATTTTGTCTTAATATTGTTGACAATTCTGTAAAGTTCCTTTTT
ATGAATATTTCTGTTTAAGCTATTTCACCTTTCTTTTGAAATCCTTCCCTTTTAAGGAGAAAATGTGACACTTGTGAAAAAGCTTGTAAG
AAAGCCCCTCCCTTTTTTCTTTAAACCTTTAAATGACAAATCTAGGTAATTAAGGTTGTGAATTTTTATTTTTGCTTTGTTTTTAATGAA
CATTTGTCTTTCAGAATAGGATTGTGTGATAATGTTTAAATGGCAAAAACAAAACATGATTTTGTGCAATTAACAAAGCTACTGCAAGAA

>In-frame_ADCY9_ENST00000294016_chr16_4038995_-_GLYR1_ENST00000591451_chr16_4862249_-_3579nt
GCGGCCGCGGCGGGAGCGGCGGCGCACTCGGGGGGAAGCAGGCCCCACTAGACGGGCCGCGCCGACGGGCTCCGCGCACTCGCAGCCCGG
GGCGCCCCCACCCCCAGCGCCCGCCGCCGCGGGCAGGGCCGGCCCGGAGCGCGGGGGGCGGCCGGGGAGCGCGAGCCGGGGGCGCCCGCC
GAAGCTCGCTGCTCCGGGTCGGGGTCCGGGCCCGGGGCCGGCCGCGCGCCGCCTTTGACGCATCGGAGCGCGGCTCCTGCAGGATGGAGG
GCTCCGCGCCGCCAGCGGAGTTGTTTGTGCGCAGGCGGCTCGCGGGGCTGGGAGCGCTCAAGGTCTGAACTTCCCTCCGGAGCCGCAGCT
GGAGGAGGCGAGCGCGCGAGGAGGAGAAGCCGCGCGGCGCGGAGGCCACCCTCGGGGCGAGAGGCGCGGAAGGCGAGCGAGCAAAGCGGT
CCCGGAGCCACGGCGGCCACGCGGCGGGGACCCCCGGGCGTTCTAGGTACTGGTGACCCCGGCCGGGGCAGGCCCCGGGACTCGACAACA
TGGCTTCCCCACCCCACCAGCAGCTGCTGCATCACCACAGCACCGAGGTGAGCTGCGACTCCAGCGGGGACAGCAACAGCGTGCGCGTCA
AGATCAACCCCAAGCAGCTGTCCTCCAACAGCCACCCCAAGCACTGCAAATACAGCATCTCCTCTAGCTGCAGCAGCTCTGGGGACTCCG
GGGGCGTCCCCCGGCGAGTGGGCGGCGGAGGCCGGCTGCGCAGGCAGAAGAAGCTGCCCCAGCTGTTCGAGAGGGCCTCCAGCCGCTGGT
GGGACCCCAAGTTCGACTCGGTGAACCTGGAGGAGGCCTGCCTGGAGCGCTGCTTCCCGCAGACCCAGCGCCGGTTCCGGTATGCGCTCT
TCTACATCGGCTTCGCCTGCCTTCTGTGGAGCATCTATTTTGCGGTCCACATGAGATCCAGACTGATCGTCATGGTCGCCCCCGCGCTGT
GCTTCCTCCTGGTGTGTGTGGGCTTCTTTCTGTTTACCTTCACCAAGCTGTACGCCCGGCATTACGCGTGGACCTCGCTGGCTCTCACCC
TGCTGGTGTTCGCCCTGACCCTGGCTGCGCAGTTCCAGGTCTTGACGCCTGTCTCAGGACGCGGCGACAGCTCCAACCTTACGGCCACAG
CCCGGCCCACAGATACTTGCTTATCTCAAGTGGGGAGCTTCTCCATGTGCATCGAAGTGCTCTTTTTGCTCTATACCGTCATGCACTTAC
CTTTGTACCTGAGTTTGTGTCTGGGGGTGGCCTACTCTGTCCTTTTCGAGACCTTTGGCTACCATTTCCGGGATGAAGCCTGCTTCCCCT
CGCCCGGAGCCGGGGCCCTGCACTGGGAGCTGCTGAGCAGGGGGCTGCTCCACGGCTGCATCCACGCCATCGGGGTCCACCTGTTCGTCA
TGTCCCAGGTGAGGTCCAGGAGCACCTTCCTCAAGGTGGGGCAATCCATTATGCACGGGAAGGACCTGGAAGTGGAAAAAGCCCTCAAAG
AGAGGATGATTCATTCCGTGATGCCAAGAATCATAGCCGATGACTTAATGAAGCAGGGAGATGAGGAGAGTGAGAATTCTGTCAAGAGGC
ATGCCACCTCGAGCCCCAAGAACAGGAAGAAAAAGTCTTCCATCCAAAAAGCTCCTATAGCCTTCCGCCCTTTTAAGATGCAGCAGATCG
AAGAAGTCAGTATTTTATTTGCAGATATCGTGGGCTTCACCAAGATGAGTGCCAACAAGTCTGCCCACGCCCTGGTGGGTCTCCTGAACG
ATCTGTTCGGTCGCTTCGACCGCCTGTGTGAGGAGACCAAGTGTGAGAAAATCAGCACCCTGGGAGACTGTTACTACTGCGTGGCGGGCT
GTCCCGAGCCCCGGGCCGACCATGCCTACTGCTGCATCGAGATGGGCCTGGGCATGATCAAGGCCATCGAGCAGTTCTGCCAGGAGAAGA
AGGAGATGGTGAACATGAGAGTCGGGGTGCACACGGGCACCGTCCTTTGCGGCATCCTGGGCATGAGGAGGTTTAAATTTGACGTGTGGT
CCAACGATGTGAACCTGGCCAATCTCATGGAGCAGCTGGGAGTGGCCGGCAAAGTTCACATTTCTGAGGCCACCGCAAAATACTTAGATG
ACCGGTACGAAATGGAAGATGGGAAAGTTATTGAACGGCTGGGCCAGAGCGTGGTTGCTGACCAGTTGAAAGGTTTGAAGACATACCTGA
TATCGGGTCAGAGAGCCAAGGAGTCTCGCTGCAGCTGTGCAGAGGCCTTGCTTTCTGGCTTTGAGGTCATTGACGGCTCACAGGTGTCCT
CAGGCCCTAGGGGACAGGGGACAGCGTCATCAGGGAATGTCAGTGACTTGGCGCAGACTGTCAAAACCTTTGATAACCTTAAGACCTGCC
CTTCGTGCGGAATCACATTTGCTCCCAAATCTGAAGCCGGCGCCGAGGGAGGAGCACCTCAAAACGGCTGCCAAGACGAGCATAAAAACA
GCACCAAGGCTTCTGGAGGACCTAATCCCAAAACTCAGAACGGGCTCCTCAGCCCTCCCCAAGAGGAGAAGCTCACCAACAGTCAGACTT
CTCTGTGTGAGATCTTGCAGGAGAAGGGAAGGTGGGCAGGGGTGAGCCTGGACCAGTCGGCTCTCCTTCCGCTGAGGTTCAAGAACATCC
GGGAGAAAACGGACGCCCACTTTGTGGACGTTATCAAAGAAGACAGCCTGATGAAAGATTACTTTTTTAAGCCGCCCATTAATCAGTTCA
GCCTGAACTTCCTGGATCAGGAGCTGGAGCGATCCTACAGGACCAGCTATCAGGAAGAGGTGATTGTGTCCAGGGGGGGGCGCTTTCTGG
AAGCCCCCGTCTCAGGGAATCAGCAGCTGTCTAATGACGGGATGTTGGTGATCTTAGCGGCTGGAGACAGGGGCTTATATGAGGACTGCA
GCAGCTGCTTCCAGGCGATGGGGAAGACCTCCTTCTTCCTAGGTGAAGTGGGCAATGCAGCCAAGATGATGCTGATCGTGAACATGGTCC
AAGGGAGCTTCATGGCCACTATTGCCGAGGGGCTGACCCTGGCCCACGTGACAGGCCAGTCCCAGCAGACACTCTTGGACATCCTCAATC
AGGGACAGTTGGCCAGCATCTTCCTGGACCAGAAGTGCCAAAATATCCTGCAAGGAAACTTTAAGCCTGATTTCTACCTGAAATACATTC
AGAAGGATCTCCGCTTAGCCATTGCGCTGGGTGATGCGGTCAACCATCCGACTCCCATGGCAGCTGCAGCAAATGAGGTGTACAAAAGAG
CCAAGGCGCTGGACCAGTCTGACAACGATATGTCCGCCGTGTACCGAGCCTACATACACTAAGCTGTCGACACCCCGCCCTCACCCCTCC
AATCCCCCCTCTGACCCCCTCTTCCTCACATGGGGTCGGGGGCCTGGGAGTTCATTCTGGACCAGCCCACCTATCTCCATTTCCTTTTAT


Top

FusionGenePPI for ADCY9_GLYR1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ADCY9POPDC2, LGALS3, AREG, STX7, CD27, LGALS8, GINM1, HSPB1, TMEM17, CDH1, TPTE, TMEM194A, PIANP, GPR21, SLC20A1, PXYLP1, IER3IP1GLYR1ELAVL1, SIRT7, DHX9, ESR1, GEMIN4, KDM1A, WHSC1L1, CCNC, FHL2, EIF1AD, C6orf165, HIST3H3, SUZ12, EED, RNF2, RPL8, NPM1, MAGEA1, PRR11, ILF2, NEFH, BLK, HAL, KDM1B, LCP1, SERPINA12, CAPNS2, FNTB, ALOXE3, DDX18, FBL, NOP56, NOP58, RCC1, RFC1, TOP2A, TOP2B, NOC2L, IFI16, MED4, HIST1H3E, HNRNPU, FOXL2, CDC14B, WDR46, ZNF2, RPL37A, GLTSCR2, RPL28, CNBP, DGCR8, HIST1H1E, RPL30, ZC3HAV1, RRP8, STAU1, ZCRB1, H2AFY2, PRDM5, PPAN, RPL18A, FGF8, GPATCH4, PDGFB, CDX1, ECM1, PLEKHO1, RRS1, RSBN1, RBM4, RBM34, KNOP1, HIST1H3A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneGLYR1chr16:4038995chr16:4862249ENST00000321919-1116214_217373554histone H3
TgeneGLYR1chr16:4038995chr16:4862249ENST00000381983-1015214_217356537histone H3
TgeneGLYR1chr16:4038995chr16:4862249ENST00000436648-1015214_217292473histone H3
TgeneGLYR1chr16:4038995chr16:4862249ENST00000591451-1116214_217367548histone H3
TgeneGLYR1chr16:4038995chr16:4862249ENST00000321919-1116216_225373554KDM1B
TgeneGLYR1chr16:4038995chr16:4862249ENST00000381983-1015216_225356537KDM1B
TgeneGLYR1chr16:4038995chr16:4862249ENST00000436648-1015216_225292473KDM1B
TgeneGLYR1chr16:4038995chr16:4862249ENST00000591451-1116216_225367548KDM1B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ADCY9_GLYR1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ADCY9_GLYR1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource