FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8429

FusionGeneSummary for CREBBP_GOLGA6L2

check button Fusion gene summary
Fusion gene informationFusion gene name: CREBBP_GOLGA6L2
Fusion gene ID: 8429
HgeneTgene
Gene symbol

CREBBP

GOLGA6L2

Gene ID

1387

283685

Gene nameCREB binding proteingolgin A6 family-like 2
SynonymsCBP|KAT3A|RSTS|RSTS1CT105
Cytomap

16p13.3

15q11.2

Type of geneprotein-codingprotein-coding
DescriptionCREB-binding proteingolgin subfamily A member 6-like protein 2cancer/testis antigen 105golgi autoantigen, golgin subfamily a, 6-like 2
Modification date2018052220180519
UniProtAcc

Q92793

Q8N9W4

Ensembl transtripts involved in fusion geneENST00000262367, ENST00000382070, 
ENST00000567107, ENST00000345070, 
ENST00000312015, 
Fusion gene scores* DoF score25 X 18 X 14=63001 X 1 X 1=1
# samples 341
** MAII scorelog2(34/6300*10)=-4.21174517713694
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: CREBBP [Title/Abstract] AND GOLGA6L2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCREBBP

GO:0000122

negative regulation of transcription by RNA polymerase II

21539536

HgeneCREBBP

GO:0006355

regulation of transcription, DNA-templated

12169688

HgeneCREBBP

GO:0006473

protein acetylation

15273251|24939902

HgeneCREBBP

GO:0016573

histone acetylation

11742995

HgeneCREBBP

GO:0018076

N-terminal peptidyl-lysine acetylation

12435739

HgeneCREBBP

GO:0034644

cellular response to UV

24939902

HgeneCREBBP

GO:0045893

positive regulation of transcription, DNA-templated

11742995


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLGGTCGA-KT-A7W1-01ACREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262367ENST00000567107CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
5CDS-5UTRENST00000262367ENST00000345070CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
5CDS-5UTRENST00000262367ENST00000312015CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
In-frameENST00000382070ENST00000567107CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
5CDS-5UTRENST00000382070ENST00000345070CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-
5CDS-5UTRENST00000382070ENST00000312015CREBBPchr16

3900298

-GOLGA6L2chr15

23690585

-

Top

FusionProtFeatures for CREBBP_GOLGA6L2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CREBBP

Q92793

GOLGA6L2

Q8N9W4

Acetylates histones, giving a specific tag fortranscriptional activation. Also acetylates non-histone proteins,like NCOA3 and FOXO1. Binds specifically to phosphorylated CREBand enhances its transcriptional activity toward cAMP-responsivegenes. Acts as a coactivator of ALX1. Acts as a circadiantranscriptional coactivator which enhances the activity of thecircadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. Acetylates PCNA; acetylation promotesremoval of chromatin-bound PCNA and its degradation duringnucleotide excision repair (NER) (PubMed:24939902).{ECO:0000269|PubMed:11154691, ECO:0000269|PubMed:12738767,ECO:0000269|PubMed:12929931, ECO:0000269|PubMed:14645221,ECO:0000269|PubMed:24939902, ECO:0000269|PubMed:9707565}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGOLGA6L2chr16:3900298chr15:23690585ENST00000312015-09192_52628651Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311061_10642662443Compositional biasNote=Poly-Glu
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311199_14872662443Compositional biasNote=Cys/His-rich
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311555_15622662443Compositional biasNote=Poly-Glu
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311943_19482662443Compositional biasNote=Poly-Pro
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311967_19702662443Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2312081_20852662443Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2312199_22162662443Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2312245_22482662443Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2312297_23002662443Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301061_10642662405Compositional biasNote=Poly-Glu
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301199_14872662405Compositional biasNote=Cys/His-rich
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301555_15622662405Compositional biasNote=Poly-Glu
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301943_19482662405Compositional biasNote=Poly-Pro
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301967_19702662405Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2302081_20852662405Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2302199_22162662405Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2302245_22482662405Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2302297_23002662405Compositional biasNote=Poly-Gln
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311103_11752662443DomainBromo
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311323_17002662443DomainCBP/p300-type HAT
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-231587_6662662443DomainKIX
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301103_11752662405DomainBromo
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301323_17002662405DomainCBP/p300-type HAT
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-230587_6662662405DomainKIX
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311434_14362662443RegionAcetyl-CoA binding
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311446_14472662443RegionAcetyl-CoA binding
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301434_14362662405RegionAcetyl-CoA binding
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301446_14472662405RegionAcetyl-CoA binding
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311701_17442662443Zinc fingerZZ-type
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311765_18462662443Zinc fingerTAZ-type 2
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-231347_4332662443Zinc fingerTAZ-type 1
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301701_17442662405Zinc fingerZZ-type
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301765_18462662405Zinc fingerTAZ-type 2
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-230347_4332662405Zinc fingerTAZ-type 1


Top

FusionGeneSequence for CREBBP_GOLGA6L2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CREBBP_ENST00000262367_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_1148aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVS
ASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKFTDT
RQWNIAGVGTRATDTKKKKINNGTNPETTTSEGCHSPEDTQQNRAQLKEEKKASHQHQEALRREIEAQDHTIRILTCQKTELETALTYSQ
DAARKFEDGNLGTPSSFNLALSQAFRGSPLGCVSTSLIPGESKDLAGRLHHSWHFAGELQRALSAVSTWHKKADRYIEELTKERDALSLE
LYRNTITNEELKKKNAELQEKLRLAESEKSEIQLNVKELKRKLERAKFLLPQVQTNTLQEEMWRQEEELREQEKKIRKQEEKMWRQEERL
REQEGKMREQEEKMRRQEKRLREQEKELREQEKELREQKKLREQEEQMQEQEEKMWEQEEKMREQEEKMWRQEERLWEQEKQMREQEQKM
RDQEERMWEQDERLREKEERMREQEKMWEQVEKMREEKKMQEQEKKTRDQEEKMQEEERIREREKKMREEEETMREQEEKMQKQEENMWE
QEEKEWQQQRLPEQKEKLWEQEKMQEQEEKIWEQEEKIRDQEEMWGQEKKMWRQEKMREQEDVETGGEAAGAGEADVGAGGEDAGSGAED
VGPGGEDVGAGREAAGEGGENAGAEEDVAAGGEDAGGEEDAGAGEEDMGPGGEDARGGEDAGAGEEDAGGGGDDAGAGGEDAGAGREDAG
AGGEDVGAGREDAGAGGEDVGAGGEDVGAGRRRCGSSRGCRNRRRSCGNTRRCRSRRSGAEDVGPEGEDVGAGREAAGEGGENAGAEDVA
AGGEDAGEEEDAGGEDAGAAREDAGAGGDDVGAGREDAGAGGEDVGAGGEDAGAGGEDAGAGGEDAGPGGEDAGAGGEDAGPGGEDAGAG

>In-frame_CREBBP_ENST00000382070_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_1148aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVS
ASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKFTDT
RQWNIAGVGTRATDTKKKKINNGTNPETTTSEGCHSPEDTQQNRAQLKEEKKASHQHQEALRREIEAQDHTIRILTCQKTELETALTYSQ
DAARKFEDGNLGTPSSFNLALSQAFRGSPLGCVSTSLIPGESKDLAGRLHHSWHFAGELQRALSAVSTWHKKADRYIEELTKERDALSLE
LYRNTITNEELKKKNAELQEKLRLAESEKSEIQLNVKELKRKLERAKFLLPQVQTNTLQEEMWRQEEELREQEKKIRKQEEKMWRQEERL
REQEGKMREQEEKMRRQEKRLREQEKELREQEKELREQKKLREQEEQMQEQEEKMWEQEEKMREQEEKMWRQEERLWEQEKQMREQEQKM
RDQEERMWEQDERLREKEERMREQEKMWEQVEKMREEKKMQEQEKKTRDQEEKMQEEERIREREKKMREEEETMREQEEKMQKQEENMWE
QEEKEWQQQRLPEQKEKLWEQEKMQEQEEKIWEQEEKIRDQEEMWGQEKKMWRQEKMREQEDVETGGEAAGAGEADVGAGGEDAGSGAED
VGPGGEDVGAGREAAGEGGENAGAEEDVAAGGEDAGGEEDAGAGEEDMGPGGEDARGGEDAGAGEEDAGGGGDDAGAGGEDAGAGREDAG
AGGEDVGAGREDAGAGGEDVGAGGEDVGAGRRRCGSSRGCRNRRRSCGNTRRCRSRRSGAEDVGPEGEDVGAGREAAGEGGENAGAEDVA
AGGEDAGEEEDAGGEDAGAAREDAGAGGDDVGAGREDAGAGGEDVGAGGEDAGAGGEDAGAGGEDAGPGGEDAGAGGEDAGPGGEDAGAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CREBBP_ENST00000262367_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_3444nt
ATGGCTGAGAACTTGCTGGACGGACCGCCCAACCCCAAAAGAGCCAAACTCAGCTCGCCCGGTTTCTCGGCGAATGACAGCACAGATTTT
GGATCATTGTTTGACTTGGAAAATGATCTTCCTGATGAGCTGATACCCAATGGAGGAGAATTAGGCCTTTTAAACAGTGGGAACCTTGTT
CCAGATGCTGCTTCCAAACATAAACAACTGTCGGAGCTTCTACGAGGAGGCAGCGGCTCTAGTATCAACCCAGGAATAGGAAATGTGAGC
GCCAGCAGCCCCGTGCAGCAGGGCCTGGGTGGCCAGGCTCAAGGGCAGCCGAACAGTGCTAACATGGCCAGCCTCAGTGCCATGGGCAAG
AGCCCTCTGAGCCAGGGAGATTCTTCAGCCCCCAGCCTGCCTAAACAGGCAGCCAGCACCTCTGGGCCCACCCCCGCTGCCTCCCAAGCA
CTGAATCCGCAAGCACAAAAGCAAGTGGGGCTGGCGACTAGCAGCCCTGCCACGTCACAGACTGGACCTGGTATCTGCATGAATGCTAAC
TTTAACCAGACCCACCCAGGCCTCCTCAATAGTAACTCTGGCCATAGCTTAATTAATCAGGCTTCACAAGGGCAGGCGCAAGTCATGAAT
GGATCTCTTGGGGCTGCTGGCAGAGGAAGGGGAGCTGGAATGCCGTACCCTACTCCAGCCATGCAGGGCGCCTCGAGCAGCGTGCTGGCT
GAGACCCTAACGCAGGTTTCCCCGCAAATGACTGGTCACGCGGGACTGAACACCGCACAGGCAGGAGGCATGGCCAAGTTTACAGACTAT
CGTCAGTGGAACATTGCTGGTGTTGGTACCAGAGCAACTGACACCAAAAAGAAGAAAATAAATAATGGCACTAACCCTGAGACAACCACT
TCGGAGGGTTGCCATTCACCTGAGGATACACAACAGAACCGAGCGCAGCTGAAAGAAGAAAAGAAGGCAAGCCACCAACATCAGGAAGCC
CTAAGGCGGGAGATAGAGGCCCAGGATCATACAATACGAATTCTCACGTGTCAGAAAACTGAACTGGAGACAGCGCTCTATTACAGCCAG
GATGCTGCCAGGAAATTTGAAGATGGGAACCTGGGCACCCCATCATCCTTCAACCTGGCACTTTCACAGGCCTTTAGGGGGAGTCCTTTG
GGCTGTGTCTCAACCTCTCTCATTCCAGGAGAGTCCAAGGATCTCGCCGGCCGCTTGCATCATTCCTGGCACTTTGCAGGAGAGTTACAG
CGGGCTCTCTCTGCTGTGTCCACATGGCACAAGAAGGCAGACAGGTACATCGAGGAGTTAACAAAGGAGAGGGACGCCCTGAGTCTGGAA
CTGTACAGGAACACCATAACCAATGAGGAGCTGAAGAAGAAAAATGCCGAACTACAAGAAAAACTTCGACTTGCAGAATCTGAAAAGTCT
GAGATCCAGCTCAACGTGAAGGAGCTAAAAAGGAAACTGGAGAGGGCCAAGTTCCTGCTGCCACAGGTTCAAACCAACACTTTGCAGGAG
GAGATGTGGAGGCAGGAGGAGGAGCTACGGGAGCAGGAAAAGAAGATACGGAAGCAGGAGGAGAAGATGTGGAGACAGGAGGAGAGACTG
CGGGAGCAGGAGGGGAAGATGCGGGAGCAGGAGGAGAAGATGCGGAGACAGGAGAAGAGGCTGCGAGAGCAGGAGAAGGAGCTGCGGGAG
CAGGAGAAGGAGCTGCGGGAGCAGAAGAAGCTGCGGGAGCAGGAGGAGCAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAG
AAGATGCGGGAGCAGGAAGAGAAGATGTGGAGACAGGAGGAGAGGCTGTGGGAGCAGGAGAAGCAGATGCGGGAGCAGGAGCAGAAGATG
CGGGACCAAGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTACGGGAGAAGGAGGAGAGGATGCGGGAGCAGGAGAAGATGTGGGAGCAG
GTGGAGAAGATGCGGGAGGAGAAGAAGATGCAGGAGCAGGAGAAGAAGACGCGGGACCAGGAGGAGAAGATGCAAGAGGAGGAGAGGATA
CGGGAGCGGGAGAAGAAGATGCGGGAAGAGGAGGAGACGATGCGGGAGCAGGAGGAGAAGATGCAGAAGCAGGAGGAGAATATGTGGGAG
CAGGAAGAGAAGGAGTGGCAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACAGGAGAAGATGCAGGAGCAGGAGGAGAAG
ATATGGGAGCAGGAGGAGAAGATACGGGACCAGGAGGAGATGTGGGGGCAGGAGAAGAAGATGTGGCGGCAGGAGAAGATGCGGGAGCAG
GAAGATGTGGAGACAGGAGGAGAGGCTGCAGGAGCAGGAGAAGCAGATGTGGGAGCAGGAGGAGAAGATGCGGGATCAGGAGCAGAAGAT
GTGGGACCAGGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGAAGATGTGGCAGCA
GGAGGAGAAGATGCGGGAGGAGAAGAAGACGCAGGAGCAGGAGAAGAAGACATGGGACCAGGAGGAGAAGATGCGAGAGGAGGAGAGGAT
GCGGGAGCGGGAGAAGAAGATGCGGGAGGAGGAGGAGATGATGCGGGAGCAGGAGGAGAAGATGCAGGAGCAGGAAGAGAAGATGCGGGA
GCAGGAGGAGAAGATGTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGTGGGAGCAGGA
AGAAGAAGATGTGGGAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACACGAGAAGATGCAGGAGCAGGAGATCAGGAGCA
GAAGATGTGGGACCAGAAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGATGTGGCA
GCAGGTGGAGAAGATGCGGGAGAAGAAGAAGACGCAGGAGGAGAAGATGCAGGAGCAGCAAGAGAAGATGCAGGAGCAGGAGGAGATGAT
GTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCGGGA
GCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGA
GGAGAAGATGCGGGGCCAGGAGGAGAAGATGTGGGGCCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAT
GCGAGAGAAGGAGGAGAGGATACGAGATCAGAAAGAGAAGATGCAGGAGAGGCTGCCAGAGCACGAGGAGCGGTGCTCAGAGCCCTGCCT

>In-frame_CREBBP_ENST00000382070_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_3444nt
ATGGCTGAGAACTTGCTGGACGGACCGCCCAACCCCAAAAGAGCCAAACTCAGCTCGCCCGGTTTCTCGGCGAATGACAGCACAGATTTT
GGATCATTGTTTGACTTGGAAAATGATCTTCCTGATGAGCTGATACCCAATGGAGGAGAATTAGGCCTTTTAAACAGTGGGAACCTTGTT
CCAGATGCTGCTTCCAAACATAAACAACTGTCGGAGCTTCTACGAGGAGGCAGCGGCTCTAGTATCAACCCAGGAATAGGAAATGTGAGC
GCCAGCAGCCCCGTGCAGCAGGGCCTGGGTGGCCAGGCTCAAGGGCAGCCGAACAGTGCTAACATGGCCAGCCTCAGTGCCATGGGCAAG
AGCCCTCTGAGCCAGGGAGATTCTTCAGCCCCCAGCCTGCCTAAACAGGCAGCCAGCACCTCTGGGCCCACCCCCGCTGCCTCCCAAGCA
CTGAATCCGCAAGCACAAAAGCAAGTGGGGCTGGCGACTAGCAGCCCTGCCACGTCACAGACTGGACCTGGTATCTGCATGAATGCTAAC
TTTAACCAGACCCACCCAGGCCTCCTCAATAGTAACTCTGGCCATAGCTTAATTAATCAGGCTTCACAAGGGCAGGCGCAAGTCATGAAT
GGATCTCTTGGGGCTGCTGGCAGAGGAAGGGGAGCTGGAATGCCGTACCCTACTCCAGCCATGCAGGGCGCCTCGAGCAGCGTGCTGGCT
GAGACCCTAACGCAGGTTTCCCCGCAAATGACTGGTCACGCGGGACTGAACACCGCACAGGCAGGAGGCATGGCCAAGTTTACAGACTAT
CGTCAGTGGAACATTGCTGGTGTTGGTACCAGAGCAACTGACACCAAAAAGAAGAAAATAAATAATGGCACTAACCCTGAGACAACCACT
TCGGAGGGTTGCCATTCACCTGAGGATACACAACAGAACCGAGCGCAGCTGAAAGAAGAAAAGAAGGCAAGCCACCAACATCAGGAAGCC
CTAAGGCGGGAGATAGAGGCCCAGGATCATACAATACGAATTCTCACGTGTCAGAAAACTGAACTGGAGACAGCGCTCTATTACAGCCAG
GATGCTGCCAGGAAATTTGAAGATGGGAACCTGGGCACCCCATCATCCTTCAACCTGGCACTTTCACAGGCCTTTAGGGGGAGTCCTTTG
GGCTGTGTCTCAACCTCTCTCATTCCAGGAGAGTCCAAGGATCTCGCCGGCCGCTTGCATCATTCCTGGCACTTTGCAGGAGAGTTACAG
CGGGCTCTCTCTGCTGTGTCCACATGGCACAAGAAGGCAGACAGGTACATCGAGGAGTTAACAAAGGAGAGGGACGCCCTGAGTCTGGAA
CTGTACAGGAACACCATAACCAATGAGGAGCTGAAGAAGAAAAATGCCGAACTACAAGAAAAACTTCGACTTGCAGAATCTGAAAAGTCT
GAGATCCAGCTCAACGTGAAGGAGCTAAAAAGGAAACTGGAGAGGGCCAAGTTCCTGCTGCCACAGGTTCAAACCAACACTTTGCAGGAG
GAGATGTGGAGGCAGGAGGAGGAGCTACGGGAGCAGGAAAAGAAGATACGGAAGCAGGAGGAGAAGATGTGGAGACAGGAGGAGAGACTG
CGGGAGCAGGAGGGGAAGATGCGGGAGCAGGAGGAGAAGATGCGGAGACAGGAGAAGAGGCTGCGAGAGCAGGAGAAGGAGCTGCGGGAG
CAGGAGAAGGAGCTGCGGGAGCAGAAGAAGCTGCGGGAGCAGGAGGAGCAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAG
AAGATGCGGGAGCAGGAAGAGAAGATGTGGAGACAGGAGGAGAGGCTGTGGGAGCAGGAGAAGCAGATGCGGGAGCAGGAGCAGAAGATG
CGGGACCAAGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTACGGGAGAAGGAGGAGAGGATGCGGGAGCAGGAGAAGATGTGGGAGCAG
GTGGAGAAGATGCGGGAGGAGAAGAAGATGCAGGAGCAGGAGAAGAAGACGCGGGACCAGGAGGAGAAGATGCAAGAGGAGGAGAGGATA
CGGGAGCGGGAGAAGAAGATGCGGGAAGAGGAGGAGACGATGCGGGAGCAGGAGGAGAAGATGCAGAAGCAGGAGGAGAATATGTGGGAG
CAGGAAGAGAAGGAGTGGCAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACAGGAGAAGATGCAGGAGCAGGAGGAGAAG
ATATGGGAGCAGGAGGAGAAGATACGGGACCAGGAGGAGATGTGGGGGCAGGAGAAGAAGATGTGGCGGCAGGAGAAGATGCGGGAGCAG
GAAGATGTGGAGACAGGAGGAGAGGCTGCAGGAGCAGGAGAAGCAGATGTGGGAGCAGGAGGAGAAGATGCGGGATCAGGAGCAGAAGAT
GTGGGACCAGGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGAAGATGTGGCAGCA
GGAGGAGAAGATGCGGGAGGAGAAGAAGACGCAGGAGCAGGAGAAGAAGACATGGGACCAGGAGGAGAAGATGCGAGAGGAGGAGAGGAT
GCGGGAGCGGGAGAAGAAGATGCGGGAGGAGGAGGAGATGATGCGGGAGCAGGAGGAGAAGATGCAGGAGCAGGAAGAGAAGATGCGGGA
GCAGGAGGAGAAGATGTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGTGGGAGCAGGA
AGAAGAAGATGTGGGAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACACGAGAAGATGCAGGAGCAGGAGATCAGGAGCA
GAAGATGTGGGACCAGAAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGATGTGGCA
GCAGGTGGAGAAGATGCGGGAGAAGAAGAAGACGCAGGAGGAGAAGATGCAGGAGCAGCAAGAGAAGATGCAGGAGCAGGAGGAGATGAT
GTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCGGGA
GCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGA
GGAGAAGATGCGGGGCCAGGAGGAGAAGATGTGGGGCCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAT
GCGAGAGAAGGAGGAGAGGATACGAGATCAGAAAGAGAAGATGCAGGAGAGGCTGCCAGAGCACGAGGAGCGGTGCTCAGAGCCCTGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CREBBP_ENST00000262367_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_4501nt
TTCTTTTTTTTTTAATTGAGGAATCAACAGCCGCCATCTTGTCGCGGACCCGACCGGGGCTTCGAGCGCGATCTACTCGGCCCCGCCGGT
CCCGGGCCCCACAACCGCCCGCGCACCCCGCTCCGCCCGGCCGGCCCGCTCCGCCCGGCCCTCGGCGCCCGCCCCGGCGGCCCCGCTCGC
CTCTCGGCTCGGCCTCCCGGAGCCCGGCGGCGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGAACGGGGGGTGGGGGGGCCGCGGCGGC
GGCGGCGACCCCGCTCGGCGCATTGTTTTTCCTCACGGCGGCGGCGGCGGCGGGCCGCGGGCCGGGAGCGGAGCCCGGAGCCCCCTCGTC
GTCGGGCCGCGAGCGAATTCATTAAGTGGGGCGCGGGGGGGGAGCGAGGCGGCGGCGGCGGCGGCACCATGTTCTCGGGGACTGCCTGAG
CCGCCCGGCCGGGCGCCGTCGCTGCCAGCCGGGCCCGGGGGGGCGGCCGGGCCGCCGGGGCGCCCCCACCGCGGAGTGTCGCGCTCGGGA
GGCGGGCAGGGGATGAGGGGGCCGCGGCCGGCGGCGGCGGCGGCGGCCGGGGGCGGGCGGTGAGCGCTGCGGGGCGCTGTTGCTGTGGCT
GAGATTTGGCCGCCGCCTCCCCCACCCGGCCTGCGCCCTCCCTCTCCCTCGGCGCCCGCCCGCCCGCTCGCGGCCCGCGCTCGCTCCTCT
CCCTCGCAGCCGGCAGGGCCCCCGACCCCCGTCCGGGCCCTCGCCGGCCCGGCCGCCCGTGCCCGGGGCTGTTTTCGCGAGCAGGTGAAA
ATGGCTGAGAACTTGCTGGACGGACCGCCCAACCCCAAAAGAGCCAAACTCAGCTCGCCCGGTTTCTCGGCGAATGACAGCACAGATTTT
GGATCATTGTTTGACTTGGAAAATGATCTTCCTGATGAGCTGATACCCAATGGAGGAGAATTAGGCCTTTTAAACAGTGGGAACCTTGTT
CCAGATGCTGCTTCCAAACATAAACAACTGTCGGAGCTTCTACGAGGAGGCAGCGGCTCTAGTATCAACCCAGGAATAGGAAATGTGAGC
GCCAGCAGCCCCGTGCAGCAGGGCCTGGGTGGCCAGGCTCAAGGGCAGCCGAACAGTGCTAACATGGCCAGCCTCAGTGCCATGGGCAAG
AGCCCTCTGAGCCAGGGAGATTCTTCAGCCCCCAGCCTGCCTAAACAGGCAGCCAGCACCTCTGGGCCCACCCCCGCTGCCTCCCAAGCA
CTGAATCCGCAAGCACAAAAGCAAGTGGGGCTGGCGACTAGCAGCCCTGCCACGTCACAGACTGGACCTGGTATCTGCATGAATGCTAAC
TTTAACCAGACCCACCCAGGCCTCCTCAATAGTAACTCTGGCCATAGCTTAATTAATCAGGCTTCACAAGGGCAGGCGCAAGTCATGAAT
GGATCTCTTGGGGCTGCTGGCAGAGGAAGGGGAGCTGGAATGCCGTACCCTACTCCAGCCATGCAGGGCGCCTCGAGCAGCGTGCTGGCT
GAGACCCTAACGCAGGTTTCCCCGCAAATGACTGGTCACGCGGGACTGAACACCGCACAGGCAGGAGGCATGGCCAAGTTTACAGACTAT
CGTCAGTGGAACATTGCTGGTGTTGGTACCAGAGCAACTGACACCAAAAAGAAGAAAATAAATAATGGCACTAACCCTGAGACAACCACT
TCGGAGGGTTGCCATTCACCTGAGGATACACAACAGAACCGAGCGCAGCTGAAAGAAGAAAAGAAGGCAAGCCACCAACATCAGGAAGCC
CTAAGGCGGGAGATAGAGGCCCAGGATCATACAATACGAATTCTCACGTGTCAGAAAACTGAACTGGAGACAGCGCTCTATTACAGCCAG
GATGCTGCCAGGAAATTTGAAGATGGGAACCTGGGCACCCCATCATCCTTCAACCTGGCACTTTCACAGGCCTTTAGGGGGAGTCCTTTG
GGCTGTGTCTCAACCTCTCTCATTCCAGGAGAGTCCAAGGATCTCGCCGGCCGCTTGCATCATTCCTGGCACTTTGCAGGAGAGTTACAG
CGGGCTCTCTCTGCTGTGTCCACATGGCACAAGAAGGCAGACAGGTACATCGAGGAGTTAACAAAGGAGAGGGACGCCCTGAGTCTGGAA
CTGTACAGGAACACCATAACCAATGAGGAGCTGAAGAAGAAAAATGCCGAACTACAAGAAAAACTTCGACTTGCAGAATCTGAAAAGTCT
GAGATCCAGCTCAACGTGAAGGAGCTAAAAAGGAAACTGGAGAGGGCCAAGTTCCTGCTGCCACAGGTTCAAACCAACACTTTGCAGGAG
GAGATGTGGAGGCAGGAGGAGGAGCTACGGGAGCAGGAAAAGAAGATACGGAAGCAGGAGGAGAAGATGTGGAGACAGGAGGAGAGACTG
CGGGAGCAGGAGGGGAAGATGCGGGAGCAGGAGGAGAAGATGCGGAGACAGGAGAAGAGGCTGCGAGAGCAGGAGAAGGAGCTGCGGGAG
CAGGAGAAGGAGCTGCGGGAGCAGAAGAAGCTGCGGGAGCAGGAGGAGCAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAG
AAGATGCGGGAGCAGGAAGAGAAGATGTGGAGACAGGAGGAGAGGCTGTGGGAGCAGGAGAAGCAGATGCGGGAGCAGGAGCAGAAGATG
CGGGACCAAGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTACGGGAGAAGGAGGAGAGGATGCGGGAGCAGGAGAAGATGTGGGAGCAG
GTGGAGAAGATGCGGGAGGAGAAGAAGATGCAGGAGCAGGAGAAGAAGACGCGGGACCAGGAGGAGAAGATGCAAGAGGAGGAGAGGATA
CGGGAGCGGGAGAAGAAGATGCGGGAAGAGGAGGAGACGATGCGGGAGCAGGAGGAGAAGATGCAGAAGCAGGAGGAGAATATGTGGGAG
CAGGAAGAGAAGGAGTGGCAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACAGGAGAAGATGCAGGAGCAGGAGGAGAAG
ATATGGGAGCAGGAGGAGAAGATACGGGACCAGGAGGAGATGTGGGGGCAGGAGAAGAAGATGTGGCGGCAGGAGAAGATGCGGGAGCAG
GAAGATGTGGAGACAGGAGGAGAGGCTGCAGGAGCAGGAGAAGCAGATGTGGGAGCAGGAGGAGAAGATGCGGGATCAGGAGCAGAAGAT
GTGGGACCAGGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGAAGATGTGGCAGCA
GGAGGAGAAGATGCGGGAGGAGAAGAAGACGCAGGAGCAGGAGAAGAAGACATGGGACCAGGAGGAGAAGATGCGAGAGGAGGAGAGGAT
GCGGGAGCGGGAGAAGAAGATGCGGGAGGAGGAGGAGATGATGCGGGAGCAGGAGGAGAAGATGCAGGAGCAGGAAGAGAAGATGCGGGA
GCAGGAGGAGAAGATGTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGTGGGAGCAGGA
AGAAGAAGATGTGGGAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACACGAGAAGATGCAGGAGCAGGAGATCAGGAGCA
GAAGATGTGGGACCAGAAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCGGGAGCAGAAGATGTGGCA
GCAGGTGGAGAAGATGCGGGAGAAGAAGAAGACGCAGGAGGAGAAGATGCAGGAGCAGCAAGAGAAGATGCAGGAGCAGGAGGAGATGAT
GTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCGGGA
GCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGA
GGAGAAGATGCGGGGCCAGGAGGAGAAGATGTGGGGCCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAAGATGTGGGGGCAGGAGGAGAT
GCGAGAGAAGGAGGAGAGGATACGAGATCAGAAAGAGAAGATGCAGGAGAGGCTGCCAGAGCACGAGGAGCGGTGCTCAGAGCCCTGCCT
CCCTCCCTCCAAAGTTCTTTGTAATATGAGCCACACTGGCAGTGTGGAGCCTGCAGGAGGAGAGGCTGGGGAGGGTTCTCCGCAGGACAA
CCCCACTGCACAGGAGATCATGCAGCTGTTTTGTGGGATGAAGAACGCCCAGCAGTGCCCAGGATTAGGCAGTACCTCCTGCATCCCATT
CTTCTACCGAGGAGACAAGAGAAAGATGAAGATCATCAATATCTAAAAGTTGGCACTGTCAACAAGGCCTACAGAAGCATAAGCCGCCAT

>In-frame_CREBBP_ENST00000382070_chr16_3900298_-_GOLGA6L2_ENST00000567107_chr15_23690585_-_3895nt
CTGCGGGGCGCTGTTGCTGTGGCTGAGATTTGGCCGCCGCCTCCCCCACCCGGCCTGCGCCCTCCCTCTCCCTCGGCGCCCGCCCGCCCG
CTCGCGGCCCGCGCTCGCTCCTCTCCCTCGCAGCCGGCAGGGCCCCCGACCCCCGTCCGGGCCCTCGCCGGCCCGGCCGCCCGTGCCCGG
GGCTGTTTTCGCGAGCAGGTGAAAATGGCTGAGAACTTGCTGGACGGACCGCCCAACCCCAAAAGAGCCAAACTCAGCTCGCCCGGTTTC
TCGGCGAATGACAGCACAGATTTTGGATCATTGTTTGACTTGGAAAATGATCTTCCTGATGAGCTGATACCCAATGGAGGAGAATTAGGC
CTTTTAAACAGTGGGAACCTTGTTCCAGATGCTGCTTCCAAACATAAACAACTGTCGGAGCTTCTACGAGGAGGCAGCGGCTCTAGTATC
AACCCAGGAATAGGAAATGTGAGCGCCAGCAGCCCCGTGCAGCAGGGCCTGGGTGGCCAGGCTCAAGGGCAGCCGAACAGTGCTAACATG
GCCAGCCTCAGTGCCATGGGCAAGAGCCCTCTGAGCCAGGGAGATTCTTCAGCCCCCAGCCTGCCTAAACAGGCAGCCAGCACCTCTGGG
CCCACCCCCGCTGCCTCCCAAGCACTGAATCCGCAAGCACAAAAGCAAGTGGGGCTGGCGACTAGCAGCCCTGCCACGTCACAGACTGGA
CCTGGTATCTGCATGAATGCTAACTTTAACCAGACCCACCCAGGCCTCCTCAATAGTAACTCTGGCCATAGCTTAATTAATCAGGCTTCA
CAAGGGCAGGCGCAAGTCATGAATGGATCTCTTGGGGCTGCTGGCAGAGGAAGGGGAGCTGGAATGCCGTACCCTACTCCAGCCATGCAG
GGCGCCTCGAGCAGCGTGCTGGCTGAGACCCTAACGCAGGTTTCCCCGCAAATGACTGGTCACGCGGGACTGAACACCGCACAGGCAGGA
GGCATGGCCAAGTTTACAGACTATCGTCAGTGGAACATTGCTGGTGTTGGTACCAGAGCAACTGACACCAAAAAGAAGAAAATAAATAAT
GGCACTAACCCTGAGACAACCACTTCGGAGGGTTGCCATTCACCTGAGGATACACAACAGAACCGAGCGCAGCTGAAAGAAGAAAAGAAG
GCAAGCCACCAACATCAGGAAGCCCTAAGGCGGGAGATAGAGGCCCAGGATCATACAATACGAATTCTCACGTGTCAGAAAACTGAACTG
GAGACAGCGCTCTATTACAGCCAGGATGCTGCCAGGAAATTTGAAGATGGGAACCTGGGCACCCCATCATCCTTCAACCTGGCACTTTCA
CAGGCCTTTAGGGGGAGTCCTTTGGGCTGTGTCTCAACCTCTCTCATTCCAGGAGAGTCCAAGGATCTCGCCGGCCGCTTGCATCATTCC
TGGCACTTTGCAGGAGAGTTACAGCGGGCTCTCTCTGCTGTGTCCACATGGCACAAGAAGGCAGACAGGTACATCGAGGAGTTAACAAAG
GAGAGGGACGCCCTGAGTCTGGAACTGTACAGGAACACCATAACCAATGAGGAGCTGAAGAAGAAAAATGCCGAACTACAAGAAAAACTT
CGACTTGCAGAATCTGAAAAGTCTGAGATCCAGCTCAACGTGAAGGAGCTAAAAAGGAAACTGGAGAGGGCCAAGTTCCTGCTGCCACAG
GTTCAAACCAACACTTTGCAGGAGGAGATGTGGAGGCAGGAGGAGGAGCTACGGGAGCAGGAAAAGAAGATACGGAAGCAGGAGGAGAAG
ATGTGGAGACAGGAGGAGAGACTGCGGGAGCAGGAGGGGAAGATGCGGGAGCAGGAGGAGAAGATGCGGAGACAGGAGAAGAGGCTGCGA
GAGCAGGAGAAGGAGCTGCGGGAGCAGGAGAAGGAGCTGCGGGAGCAGAAGAAGCTGCGGGAGCAGGAGGAGCAGATGCAGGAGCAGGAG
GAGAAGATGTGGGAGCAGGAGGAGAAGATGCGGGAGCAGGAAGAGAAGATGTGGAGACAGGAGGAGAGGCTGTGGGAGCAGGAGAAGCAG
ATGCGGGAGCAGGAGCAGAAGATGCGGGACCAAGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTACGGGAGAAGGAGGAGAGGATGCGG
GAGCAGGAGAAGATGTGGGAGCAGGTGGAGAAGATGCGGGAGGAGAAGAAGATGCAGGAGCAGGAGAAGAAGACGCGGGACCAGGAGGAG
AAGATGCAAGAGGAGGAGAGGATACGGGAGCGGGAGAAGAAGATGCGGGAAGAGGAGGAGACGATGCGGGAGCAGGAGGAGAAGATGCAG
AAGCAGGAGGAGAATATGTGGGAGCAGGAAGAGAAGGAGTGGCAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACAGGAG
AAGATGCAGGAGCAGGAGGAGAAGATATGGGAGCAGGAGGAGAAGATACGGGACCAGGAGGAGATGTGGGGGCAGGAGAAGAAGATGTGG
CGGCAGGAGAAGATGCGGGAGCAGGAAGATGTGGAGACAGGAGGAGAGGCTGCAGGAGCAGGAGAAGCAGATGTGGGAGCAGGAGGAGAA
GATGCGGGATCAGGAGCAGAAGATGTGGGACCAGGAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAGAATGCG
GGAGCAGAAGAAGATGTGGCAGCAGGAGGAGAAGATGCGGGAGGAGAAGAAGACGCAGGAGCAGGAGAAGAAGACATGGGACCAGGAGGA
GAAGATGCGAGAGGAGGAGAGGATGCGGGAGCGGGAGAAGAAGATGCGGGAGGAGGAGGAGATGATGCGGGAGCAGGAGGAGAAGATGCA
GGAGCAGGAAGAGAAGATGCGGGAGCAGGAGGAGAAGATGTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCA
GGAGGAGAAGATGTGGGAGCAGGAAGAAGAAGATGTGGGAGCAGCAGAGGCTGCCGGAACAGAAGGAGAAGCTGTGGGAACACGAGAAGA
TGCAGGAGCAGGAGATCAGGAGCAGAAGATGTGGGACCAGAAGGAGAGGATGTGGGAGCAGGACGAGAGGCTGCGGGAGAAGGAGGAGAG
AATGCGGGAGCAGAAGATGTGGCAGCAGGTGGAGAAGATGCGGGAGAAGAAGAAGACGCAGGAGGAGAAGATGCAGGAGCAGCAAGAGAA
GATGCAGGAGCAGGAGGAGATGATGTGGGAGCAGGAAGAGAAGATGCAGGAGCAGGAGGAGAAGATGTGGGAGCAGGAGGAGAAGATGCG
GGAGCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCAGGGCCAGGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCAGGGCCA
GGAGGAGAAGATGCGGGAGCAGGAGGAGAAGATGCGGGGCCAGGAGGAGAAGATGTGGGGCCAGGAGGAGAAGATGTGGGGGCAGGAGGA
GAAGATGTGGGGGCAGGAGGAGATGCGAGAGAAGGAGGAGAGGATACGAGATCAGAAAGAGAAGATGCAGGAGAGGCTGCCAGAGCACGA
GGAGCGGTGCTCAGAGCCCTGCCTCCCTCCCTCCAAAGTTCTTTGTAATATGAGCCACACTGGCAGTGTGGAGCCTGCAGGAGGAGAGGC
TGGGGAGGGTTCTCCGCAGGACAACCCCACTGCACAGGAGATCATGCAGCTGTTTTGTGGGATGAAGAACGCCCAGCAGTGCCCAGGATT
AGGCAGTACCTCCTGCATCCCATTCTTCTACCGAGGAGACAAGAGAAAGATGAAGATCATCAATATCTAAAAGTTGGCACTGTCAACAAG


Top

FusionGenePPI for CREBBP_GOLGA6L2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CREBBPEGR1, HNF4A, NFE2L2, TDG, AIRE, NCOA6, BRCA1, CREB1, AR, N4BP2, CTNNB1, RELA, SS18L1, PIAS3, NPAS2, EBF1, E2F1, E2F3, KLF5, PML, SRF, TP53, KLF1, ING1, SMAD1, CSNK2A1, CUX1, ATF1, EWSR1, NR3C1, HNF1A, HOXB7, MSX1, HTT, TCF3, MGMT, KMT2A, MYOD1, ATF2, JUN, MECOM, GLI3, DDX5, PTMA, MYB, FOXO1, FOXO4, RPS6KA3, CITED1, STAT1, STAT6, MAF, PELP1, RPS6KA2, RBBP4, RBBP7, ONECUT1, SERTAD1, SREBF1, SREBF2, NFATC2, TRIP4, HIF1A, NFE2, STAT2, SMARCA4, NCOA1, ESR1, MAML1, MYBL2, KAT2B, GTF2B, CITED2, IRF3, NUP98, TRERF1, TGS1, KLF4, STAT3, NEUROG1, HIPK2, KHDRBS1, GATA1, PHOX2A, SNIP1, NFATC4, KLF13, XRCC6, FOS, POLR2A, SMARCB1, CCNC, CDK8, MED21, NKX2-1, NCOA3, PPARG, ATF4, RPA2, PPARGC1A, HIST3H3, HIST4H4, EP300, ANAPC7, ANAPC5, CDC16, ANAPC2, CDH1, CDC20, REL, DDX17, GCM1, MAP3K5, MAPK10, MKNK1, APC, PAPOLA, CPSF6, TBX21, NCOR1, NCOR2, CARM1, ESR2, YY1, MYC, PLAGL1, MIER1, HDAC1, SP1, SP3, HDAC3, VDR, DAXX, CEBPB, CEBPD, PARP1, PTMS, ATXN3, CTBP1, HIST1H3A, MTF1, SETD1A, MYBL1, NLK, SMAD3, DEK, FGFR1, RPS6KA1, CDKN1A, SND1, NCOA2, KAT6A, SRCAP, TAF6L, ETS1, ETS2, RUNX2, MAFK, TCF12, HDAC2, HOXB6, KPNA2, KPNA6, NR5A1, HMGA1, FOXO3, HIST1H4A, HES6, RUVBL1, FOSL1, FOSB, JUNB, FOXM1, HMGB1, HMGB2, POU1F1, IRF1, SMAD2, RARA, SH3GL1, BCL6, GRIP1, KLF8, NFYB, TRIM28, POT1, WDR5, IRF5, AKT1, CDC27, ATF3, ATG3, MDM2, HOXB2, HOXB3, HOXB9, HOXD12, HOXD13, HOXD10, HOXD4, HOXB4, HOXA10, HOXA9, PBX1, SMARCA2, MYH9, MSH6, MSH2, ZBTB2, ZNF639, ACTA2, CSNK2A2, TP73, PRLR, MED25, PTOV1, IFNAR2, IRF9, TBP, RPS6KA5, IRF7, KAT5, PYGO2, HBP1, TACC2, NPAT, CCNE1, ELAVL1, KDM3B, PSMC5, MDC1, LYN, HCK, SRC, ZCCHC12, RAD23A, RUNX1, CHUK, IKBKB, IKBKG, HIST2H2BE, LIG4, TLR2, EPAS1, MTDH, MEIS1, LDLR, DYRK1B, DYRK1A, CDK2, EID1, COPS2, PSME3, WRN, KLF2, UBE2D1, CREBBP, UBE2I, MAPK3, FHL1, HIST1H2BB, EID3, POU2F3, ELK1, MAPK1, TFDP1, CREM, ZEB1, CRTC1, MAML2, CENPJ, HSF1, FHL2, CDH2, PHOX2B, DDIT3, XAF1, BMI1, CCND3, TXNDC11, CCNA2, C3orf62, PPP1R13L, BRMS1, PCNA, UBE2S, TLE3, MUS81, PTTG1, MED23, SNAI1, TFAP2B, SMAD4, NR3C2, ARNTL, CLOCK, SUMO1, NFATC1, CPSF4, RFPL3, CTGF, NFYA, KIAA0430, HELZ, NISCH, SOWAHA, PCGF3, EIF4ENIF1, PAN2, JUP, HSPA8, LAMP2, TRIM25GOLGA6L2KRT40, SPERT, CDR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311162_11802662443ASF1A
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301162_11802662405ASF1A
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311433_14352662443histone
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301433_14352662405histone
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311124_11702662443histone
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301124_11702662405histone
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-231227_4102662443SRCAP
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-230227_4102662405SRCAP
HgeneCREBBPchr16:3900298chr15:23690585ENST00000262367-2311460_18912662443TRERF1
HgeneCREBBPchr16:3900298chr15:23690585ENST00000382070-2301460_18912662405TRERF1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CREBBP_GOLGA6L2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CREBBP_GOLGA6L2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCREBBPC0035934Rubinstein-Taybi Syndrome3CTD_human;ORPHANET;UNIPROT
HgeneCREBBPC0033578Prostatic Neoplasms2CTD_human
HgeneCREBBPC0005586Bipolar Disorder1PSYGENET
HgeneCREBBPC0005695Bladder Neoplasm1CTD_human
HgeneCREBBPC0007137Squamous cell carcinoma1CTD_human
HgeneCREBBPC0007138Carcinoma, Transitional Cell1CTD_human
HgeneCREBBPC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneCREBBPC0011573Endogenous depression1PSYGENET
HgeneCREBBPC0024301Lymphoma, Follicular1CTD_human
HgeneCREBBPC0036341Schizophrenia1PSYGENET
HgeneCREBBPC0036920Sezary Syndrome1CTD_human
HgeneCREBBPC0149925Small cell carcinoma of lung1CTD_human
HgeneCREBBPC0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneCREBBPC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneCREBBPC1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human