FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8402

FusionGeneSummary for CREB3L2_CPA2

check button Fusion gene summary
Fusion gene informationFusion gene name: CREB3L2_CPA2
Fusion gene ID: 8402
HgeneTgene
Gene symbol

CREB3L2

CPA2

Gene ID

64764

1358

Gene namecAMP responsive element binding protein 3 like 2carboxypeptidase A2
SynonymsBBF2H7-
Cytomap

7q33

7q32.2

Type of geneprotein-codingprotein-coding
Descriptioncyclic AMP-responsive element-binding protein 3-like protein 2B-ZIB transcription factorBBF2 human homolog on chromosome 7FUS/BBF2H7 proteinTCAG_1951439basic transcription factor 2cAMP-responsive element-binding protein 3-like protein 2carboxypeptidase A2carboxypeptidase A2 (pancreatic)
Modification date2018052320180523
UniProtAcc

Q70SY1

P48052

Ensembl transtripts involved in fusion geneENST00000330387, ENST00000456390, 
ENST00000452463, ENST00000458726, 
ENST00000468127, 
ENST00000222481, 
Fusion gene scores* DoF score11 X 10 X 3=3301 X 1 X 1=1
# samples 131
** MAII scorelog2(13/330*10)=-1.34395440121736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: CREB3L2 [Title/Abstract] AND CPA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCREB3L2

GO:0045893

positive regulation of transcription, DNA-templated

17178827


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5JY-01ACREB3L2chr7

137686350

-CPA2chr7

129921944

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000330387ENST00000222481CREB3L2chr7

137686350

-CPA2chr7

129921944

+
In-frameENST00000456390ENST00000222481CREB3L2chr7

137686350

-CPA2chr7

129921944

+
In-frameENST00000452463ENST00000222481CREB3L2chr7

137686350

-CPA2chr7

129921944

+
intron-3CDSENST00000458726ENST00000222481CREB3L2chr7

137686350

-CPA2chr7

129921944

+
5UTR-3CDSENST00000468127ENST00000222481CREB3L2chr7

137686350

-CPA2chr7

129921944

+

Top

FusionProtFeatures for CREB3L2_CPA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CREB3L2

Q70SY1

CPA2

P48052

Transcription factor involved in unfolded proteinresponse (UPR). In the absence of endoplasmic reticulum (ER)stress, inserted into ER membranes, with N-terminal DNA-bindingand transcription activation domains oriented toward the cytosolicface of the membrane. In response to ER stress, transported to theGolgi, where it is cleaved in a site-specific manner by residentproteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminalcytosolic domain is translocated to the nucleus to effecttranscription of specific target genes. Plays a critical role inchondrogenesis by activating the transcription of SEC23A, whichpromotes the transport and secretion of cartilage matrix proteins,and possibly that of ER biogenesis-related genes (By similarity).In a neuroblastoma cell line, protects cells from ER stress-induced death (PubMed:17178827). In vitro activates transcriptionof target genes via direct binding to the CRE site(PubMed:17178827). {ECO:0000250|UniProtKB:Q8BH52,ECO:0000269|PubMed:17178827}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112294_35734521DomainbZIP
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14294_35734249DomainbZIP
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110294_35734461DomainbZIP
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112427_43034521MotifS1P recognition
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14427_43034249MotifS1P recognition
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110427_43034461MotifS1P recognition
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112296_32534521RegionBasic motif
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112336_35734521RegionLeucine-zipper
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14296_32534249RegionBasic motif
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14336_35734249RegionLeucine-zipper
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110296_32534461RegionBasic motif
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110336_35734461RegionLeucine-zipper
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-1121_37934521Topological domainCytoplasmic
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112401_52034521Topological domainLumenal
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-141_37934249Topological domainCytoplasmic
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14401_52034249Topological domainLumenal
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-1101_37934461Topological domainCytoplasmic
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110401_52034461Topological domainLumenal
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000330387-112380_40034521TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000452463-14380_40034249TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneCREB3L2chr7:137686350chr7:129921944ENST00000456390-110380_40034461TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCPA2chr7:137686350chr7:129921944ENST00000222481+811179_182329420RegionSubstrate binding
TgeneCPA2chr7:137686350chr7:129921944ENST00000222481+811254_255329420RegionSubstrate binding
TgeneCPA2chr7:137686350chr7:129921944ENST00000222481+811307_308329420RegionSubstrate binding


Top

FusionGeneSequence for CREB3L2_CPA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CREB3L2_ENST00000330387_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_125aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSTDTGIKYSFAFELRDTG

>In-frame_CREB3L2_ENST00000456390_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_125aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSTDTGIKYSFAFELRDTG

>In-frame_CREB3L2_ENST00000452463_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_125aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSTDTGIKYSFAFELRDTG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CREB3L2_ENST00000330387_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_375nt
ATGGAGGTGCTGGAGAGCGGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCCTC
ATGTACCACACGAGTGAAGTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCTCT
GTCATCTACCAAGCCAGTGGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAGGG
CGCTACGGCTTCCTCTTGCCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGCGA

>In-frame_CREB3L2_ENST00000456390_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_375nt
ATGGAGGTGCTGGAGAGCGGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCCTC
ATGTACCACACGAGTGAAGTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCTCT
GTCATCTACCAAGCCAGTGGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAGGG
CGCTACGGCTTCCTCTTGCCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGCGA

>In-frame_CREB3L2_ENST00000452463_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_375nt
ATGGAGGTGCTGGAGAGCGGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCCTC
ATGTACCACACGAGTGAAGTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCTCT
GTCATCTACCAAGCCAGTGGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAGGG
CGCTACGGCTTCCTCTTGCCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGCGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CREB3L2_ENST00000330387_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_778nt
GTTTGTGTCTGGAGCCGTAGCGGCAAGTGGGCTTGCGGCTAAGGGATTTTCCTGGGATGAGAGCGGGTCTTCTGCCTTCATTTTGGATGC
ACATCCCGCTTTAGCCCCGGCAGCCTTTGGTCCGGCTCGTGTCCCTGGGGATTCTCGGATCTCCGAGGACACCGGACGGGAGCGCTTGGC
CATCCTCTCTCCGGCAGAGGAGCAGACGTTTGCTTTCCAAGTGCAAAACTACAGACACGCGCGCGCACACACGCAAGCACACGCGGAGAG
AGAGGAACCTTGCCGGTCCGAGGCAGCTCTGCGCGTCCCCTCCTGCGCTTAGCATCCTCGGCCCAGCGCGGCCCGCACCGCCATGGAGGT
GCTGGAGAGCGGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCCTCATGTACCA
CACGAGTGAAGTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCTCTGTCATCTA
CCAAGCCAGTGGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAGGGCGCTACGG
CTTCCTCTTGCCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGCGAGACCACCC

>In-frame_CREB3L2_ENST00000456390_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_788nt
GTCCCTCAAAGTTTGTGTCTGGAGCCGTAGCGGCAAGTGGGCTTGCGGCTAAGGGATTTTCCTGGGATGAGAGCGGGTCTTCTGCCTTCA
TTTTGGATGCACATCCCGCTTTAGCCCCGGCAGCCTTTGGTCCGGCTCGTGTCCCTGGGGATTCTCGGATCTCCGAGGACACCGGACGGG
AGCGCTTGGCCATCCTCTCTCCGGCAGAGGAGCAGACGTTTGCTTTCCAAGTGCAAAACTACAGACACGCGCGCGCACACACGCAAGCAC
ACGCGGAGAGAGAGGAACCTTGCCGGTCCGAGGCAGCTCTGCGCGTCCCCTCCTGCGCTTAGCATCCTCGGCCCAGCGCGGCCCGCACCG
CCATGGAGGTGCTGGAGAGCGGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCC
TCATGTACCACACGAGTGAAGTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCT
CTGTCATCTACCAAGCCAGTGGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAG
GGCGCTACGGCTTCCTCTTGCCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGC

>In-frame_CREB3L2_ENST00000452463_chr7_137686350_-_CPA2_ENST00000222481_chr7_129921944_+_768nt
GGAGCCGTAGCGGCAAGTGGGCTTGCGGCTAAGGGATTTTCCTGGGATGAGAGCGGGTCTTCTGCCTTCATTTTGGATGCACATCCCGCT
TTAGCCCCGGCAGCCTTTGGTCCGGCTCGTGTCCCTGGGGATTCTCGGATCTCCGAGGACACCGGACGGGAGCGCTTGGCCATCCTCTCT
CCGGCAGAGGAGCAGACGTTTGCTTTCCAAGTGCAAAACTACAGACACGCGCGCGCACACACGCAAGCACACGCGGAGAGAGAGGAACCT
TGCCGGTCCGAGGCAGCTCTGCGCGTCCCCTCCTGCGCTTAGCATCCTCGGCCCAGCGCGGCCCGCACCGCCATGGAGGTGCTGGAGAGC
GGGGAGCAGGGCGTGCTGCAGTGGGACCGCAAGCTGAGCGAGCTGTCAGAGCCCGGGGACGGCGAGGCCCTCATGTACCACACGAGTGAA
GTGGCCCAAAAGGCTGCCCAATCTCTGAGAAGCCTGCATGGCACCAAGTACAAAGTGGGACCAATCTGCTCTGTCATCTACCAAGCCAGT
GGAGGAAGCATTGACTGGTCCTATGATTATGGCATCAAGTACTCATTTGCCTTTGAACTGAGAGACACAGGGCGCTACGGCTTCCTCTTG
CCAGCCCGTCAGATCCTGCCCACAGCCGAGGAGACCTGGCTTGGCTTGAAGGCAATCATGGAGCATGTGCGAGACCACCCCTATTAGGGC


Top

FusionGenePPI for CREB3L2_CPA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CREB3L2ELAVL1, PTP4A1, RND1, ZNF212, CEP19, PXN, RGS16, GCFC2, GAS7, GULP1, CREB3, FBXW7, CREB3L1, TRIM25CPA2RBM14-RBM4, GAS6, MPZL1, ITGA4, HSPA5, INHBE, NME4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CREB3L2_CPA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CREB3L2_CPA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCPA2C0242184Hypoxia1CTD_human