FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8298

FusionGeneSummary for CPS1_MAP2

check button Fusion gene summary
Fusion gene informationFusion gene name: CPS1_MAP2
Fusion gene ID: 8298
HgeneTgene
Gene symbol

CPS1

MAP2

Gene ID

1373

10988

Gene namecarbamoyl-phosphate synthase 1methionyl aminopeptidase 2
SynonymsCPSASE1|PHNMAP2|MNPEP|p67eIF2
Cytomap

2q34

12q22

Type of geneprotein-codingprotein-coding
Descriptioncarbamoyl-phosphate synthase [ammonia], mitochondrialcarbamoyl-phosphate synthase (ammonia)carbamoyl-phosphate synthase 1, mitochondrialcarbamoylphosphate synthetase Imethionine aminopeptidase 2eIF-2-associated p67 homologinitiation factor 2-associated 67 kDa glycoproteinpeptidase M 2testicular tissue protein Li 17
Modification date2018052320180519
UniProtAcc

P31327

P11137

Ensembl transtripts involved in fusion geneENST00000430249, ENST00000233072, 
ENST00000451903, ENST00000497121, 
ENST00000199940, ENST00000360351, 
ENST00000361559, ENST00000392194, 
ENST00000447185, ENST00000475600, 
Fusion gene scores* DoF score7 X 8 X 4=2246 X 7 X 4=168
# samples 88
** MAII scorelog2(8/224*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/168*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CPS1 [Title/Abstract] AND MAP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCPS1

GO:0032496

response to lipopolysaccharide

15897806

HgeneCPS1

GO:0050667

homocysteine metabolic process

20031578

TgeneMAP2

GO:0016485

protein processing

8858118

TgeneMAP2

GO:0018206

peptidyl-methionine modification

8858118

TgeneMAP2

GO:0031365

N-terminal protein amino acid modification

8858118


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-2Y-A9H6-01ACPS1chr2

211447433

+MAP2chr2

210570304

+
TCGALDLIHCTCGA-MR-A8JO-01ACPS1chr2

211454958

+MAP2chr2

210588319

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000430249ENST00000199940CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000430249ENST00000360351CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000430249ENST00000361559CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000430249ENST00000392194CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000430249ENST00000447185CPS1chr2

211447433

+MAP2chr2

210570304

+
5CDS-3UTRENST00000430249ENST00000475600CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000233072ENST00000199940CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000233072ENST00000360351CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000233072ENST00000361559CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000233072ENST00000392194CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000233072ENST00000447185CPS1chr2

211447433

+MAP2chr2

210570304

+
5CDS-3UTRENST00000233072ENST00000475600CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000451903ENST00000199940CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000451903ENST00000360351CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000451903ENST00000361559CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000451903ENST00000392194CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000451903ENST00000447185CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3UTRENST00000451903ENST00000475600CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000497121ENST00000199940CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000497121ENST00000360351CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000497121ENST00000361559CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000497121ENST00000392194CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3CDSENST00000497121ENST00000447185CPS1chr2

211447433

+MAP2chr2

210570304

+
intron-3UTRENST00000497121ENST00000475600CPS1chr2

211447433

+MAP2chr2

210570304

+
In-frameENST00000430249ENST00000199940CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000430249ENST00000360351CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000430249ENST00000361559CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000430249ENST00000392194CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000430249ENST00000447185CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-3UTRENST00000430249ENST00000475600CPS1chr2

211454958

+MAP2chr2

210588319

+
In-frameENST00000233072ENST00000199940CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000233072ENST00000360351CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000233072ENST00000361559CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000233072ENST00000392194CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-intronENST00000233072ENST00000447185CPS1chr2

211454958

+MAP2chr2

210588319

+
5CDS-3UTRENST00000233072ENST00000475600CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-3CDSENST00000451903ENST00000199940CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000451903ENST00000360351CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000451903ENST00000361559CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000451903ENST00000392194CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000451903ENST00000447185CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-3UTRENST00000451903ENST00000475600CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-3CDSENST00000497121ENST00000199940CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000497121ENST00000360351CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000497121ENST00000361559CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000497121ENST00000392194CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-intronENST00000497121ENST00000447185CPS1chr2

211454958

+MAP2chr2

210588319

+
intron-3UTRENST00000497121ENST00000475600CPS1chr2

211454958

+MAP2chr2

210588319

+

Top

FusionProtFeatures for CPS1_MAP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CPS1

P31327

MAP2

P11137

Involved in the urea cycle of ureotelic animals wherethe enzyme plays an important role in removing excess ammonia fromthe cell. The exact function of MAP2 is unknown but MAPs maystabilize the microtubules against depolymerization. They alsoseem to have a stiffening effect on microtubules.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCPS1chr2:211454958chr2:210588319ENST00000233072+83839_2182801501RegionNote=Anthranilate phosphoribosyltransferase homolog
HgeneCPS1chr2:211454958chr2:210588319ENST00000430249+93939_2182861507RegionNote=Anthranilate phosphoribosyltransferase homolog
TgeneMAP2chr2:211447433chr2:210570304ENST00000199940+8151447_1467229560RegionCalmodulin-binding
TgeneMAP2chr2:211447433chr2:210570304ENST00000361559+6121447_1467172472RegionCalmodulin-binding
TgeneMAP2chr2:211447433chr2:210570304ENST00000392194+5111447_1467172472RegionCalmodulin-binding
TgeneMAP2chr2:211454958chr2:210588319ENST00000199940+10151447_1467392560RegionCalmodulin-binding
TgeneMAP2chr2:211454958chr2:210588319ENST00000360351+0151447_1467-1691828RegionCalmodulin-binding
TgeneMAP2chr2:211454958chr2:210588319ENST00000361559+0121447_1467-166472RegionCalmodulin-binding
TgeneMAP2chr2:211454958chr2:210588319ENST00000392194+0111447_1467-56472RegionCalmodulin-binding
TgeneMAP2chr2:211454958chr2:210588319ENST00000447185+0121447_146701824RegionCalmodulin-binding
TgeneMAP2chr2:211447433chr2:210570304ENST00000199940+8151661_1691229560RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211447433chr2:210570304ENST00000199940+8151692_1722229560RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211447433chr2:210570304ENST00000199940+8151723_1754229560RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211447433chr2:210570304ENST00000360351+9151661_169115281828RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211447433chr2:210570304ENST00000360351+9151692_172215281828RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211447433chr2:210570304ENST00000360351+9151723_175415281828RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211447433chr2:210570304ENST00000361559+6121661_1691172472RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211447433chr2:210570304ENST00000361559+6121692_1722172472RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211447433chr2:210570304ENST00000361559+6121723_1754172472RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211447433chr2:210570304ENST00000392194+5111661_1691172472RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211447433chr2:210570304ENST00000392194+5111692_1722172472RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211447433chr2:210570304ENST00000392194+5111723_1754172472RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211447433chr2:210570304ENST00000447185+6121661_169115241824RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211447433chr2:210570304ENST00000447185+6121692_172215241824RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211447433chr2:210570304ENST00000447185+6121723_175415241824RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211454958chr2:210588319ENST00000199940+10151661_1691392560RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211454958chr2:210588319ENST00000199940+10151692_1722392560RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211454958chr2:210588319ENST00000199940+10151723_1754392560RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211454958chr2:210588319ENST00000360351+0151661_1691-1691828RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211454958chr2:210588319ENST00000360351+0151692_1722-1691828RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211454958chr2:210588319ENST00000360351+0151723_1754-1691828RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211454958chr2:210588319ENST00000361559+0121661_1691-166472RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211454958chr2:210588319ENST00000361559+0121692_1722-166472RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211454958chr2:210588319ENST00000361559+0121723_1754-166472RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211454958chr2:210588319ENST00000392194+0111661_1691-56472RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211454958chr2:210588319ENST00000392194+0111692_1722-56472RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211454958chr2:210588319ENST00000392194+0111723_1754-56472RepeatNote=Tau/MAP 3
TgeneMAP2chr2:211454958chr2:210588319ENST00000447185+0121661_169101824RepeatNote=Tau/MAP 1
TgeneMAP2chr2:211454958chr2:210588319ENST00000447185+0121692_172201824RepeatNote=Tau/MAP 2
TgeneMAP2chr2:211454958chr2:210588319ENST00000447185+0121723_175401824RepeatNote=Tau/MAP 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCPS1chr2:211447433chr2:210570304ENST00000233072+6381093_12842071501DomainNote=ATP-grasp 2
HgeneCPS1chr2:211447433chr2:210570304ENST00000233072+6381355_15002071501DomainMGS-like
HgeneCPS1chr2:211447433chr2:210570304ENST00000233072+638219_4042071501DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211447433chr2:210570304ENST00000233072+638551_7432071501DomainNote=ATP-grasp 1
HgeneCPS1chr2:211447433chr2:210570304ENST00000430249+7391093_12842131507DomainNote=ATP-grasp 2
HgeneCPS1chr2:211447433chr2:210570304ENST00000430249+7391355_15002131507DomainMGS-like
HgeneCPS1chr2:211447433chr2:210570304ENST00000430249+739219_4042131507DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211447433chr2:210570304ENST00000430249+739551_7432131507DomainNote=ATP-grasp 1
HgeneCPS1chr2:211447433chr2:210570304ENST00000451903+1281093_1284-1661050DomainNote=ATP-grasp 2
HgeneCPS1chr2:211447433chr2:210570304ENST00000451903+1281355_1500-1661050DomainMGS-like
HgeneCPS1chr2:211447433chr2:210570304ENST00000451903+128219_404-1661050DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211447433chr2:210570304ENST00000451903+128551_743-1661050DomainNote=ATP-grasp 1
HgeneCPS1chr2:211454958chr2:210588319ENST00000233072+8381093_12842801501DomainNote=ATP-grasp 2
HgeneCPS1chr2:211454958chr2:210588319ENST00000233072+8381355_15002801501DomainMGS-like
HgeneCPS1chr2:211454958chr2:210588319ENST00000233072+838219_4042801501DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211454958chr2:210588319ENST00000233072+838551_7432801501DomainNote=ATP-grasp 1
HgeneCPS1chr2:211454958chr2:210588319ENST00000430249+9391093_12842861507DomainNote=ATP-grasp 2
HgeneCPS1chr2:211454958chr2:210588319ENST00000430249+9391355_15002861507DomainMGS-like
HgeneCPS1chr2:211454958chr2:210588319ENST00000430249+939219_4042861507DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211454958chr2:210588319ENST00000430249+939551_7432861507DomainNote=ATP-grasp 1
HgeneCPS1chr2:211454958chr2:210588319ENST00000451903+1281093_1284-1661050DomainNote=ATP-grasp 2
HgeneCPS1chr2:211454958chr2:210588319ENST00000451903+1281355_1500-1661050DomainMGS-like
HgeneCPS1chr2:211454958chr2:210588319ENST00000451903+128219_404-1661050DomainNote=Glutamine amidotransferase type-1
HgeneCPS1chr2:211454958chr2:210588319ENST00000451903+128551_743-1661050DomainNote=ATP-grasp 1
HgeneCPS1chr2:211447433chr2:210570304ENST00000233072+63839_2182071501RegionNote=Anthranilate phosphoribosyltransferase homolog
HgeneCPS1chr2:211447433chr2:210570304ENST00000430249+73939_2182131507RegionNote=Anthranilate phosphoribosyltransferase homolog
HgeneCPS1chr2:211447433chr2:210570304ENST00000451903+12839_218-1661050RegionNote=Anthranilate phosphoribosyltransferase homolog
HgeneCPS1chr2:211454958chr2:210588319ENST00000451903+12839_218-1661050RegionNote=Anthranilate phosphoribosyltransferase homolog
TgeneMAP2chr2:211447433chr2:210570304ENST00000360351+9151447_146715281828RegionCalmodulin-binding
TgeneMAP2chr2:211447433chr2:210570304ENST00000447185+6121447_146715241824RegionCalmodulin-binding


Top

FusionGeneSequence for CPS1_MAP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_544aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRA
GKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKS
KIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKE
KAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAK

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_513aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRA
GKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKS
KIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFR

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_513aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRA
GKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKS
KIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFR

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_513aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRA
GKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKS
KIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFR

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_513aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRA
GKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKS
KIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFR

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_538aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTS
TPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTD
NIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_507aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTS
TPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTD
NIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKAR

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_507aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTS
TPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTD
NIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKAR

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_507aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTS
TPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTD
NIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKAR

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_507aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTS
TPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTD
NIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKAR

>In-frame_CPS1_ENST00000430249_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_454aa
MPQIIKMTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAI
TDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIR
DKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGG
PGNPALAEPLIQNVRKVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKE
KAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAK

>In-frame_CPS1_ENST00000233072_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_448aa
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYK
GQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPAL
AEPLIQNVRKVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_1632nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCA
GGAGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCA
GGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGC
ACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCC
ATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCC
AAAATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAG
TCCAGATGTGGTTCCAAGGATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTG
ACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAA
AAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTC
AGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTC
AGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAG

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_1539nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCA
GGAGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCA
GGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGC
ACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCC
ATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCC
AAAATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACA
TCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAG
GCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGA
GAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGC
AATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAG

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_1539nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCA
GGAGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCA
GGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGC
ACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCC
ATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCC
AAAATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACA
TCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAG
GCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGA
GAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGC
AATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAG

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_1539nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCA
GGAGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCA
GGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGC
ACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCC
ATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCC
AAAATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACA
TCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAG
GCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGA
GAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGC
AATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAG

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_1539nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCA
GGAGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCA
GGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGC
ACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCC
ATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCC
AAAATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACA
TCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAG
GCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGA
GAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGC
AATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAG

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_1614nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTA
ACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAAT
TCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCA
ACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGC
TATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCA
AAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGAC
AACATCAAATACCAGCCTAAAGGGGGGCAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTCCAGATGTGGTTCCAAG
GATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCT
CTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTT
GGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCC
CGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCT

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_1521nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTA
ACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAAT
TCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCA
ACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGC
TATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCA
AAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGAC
AACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTG
AAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGT
TCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGT
GTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGA

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_1521nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTA
ACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAAT
TCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCA
ACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGC
TATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCA
AAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGAC
AACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTG
AAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGT
TCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGT
GTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGA

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_1521nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTA
ACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAAT
TCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCA
ACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGC
TATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCA
AAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGAC
AACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTG
AAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGT
TCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGT
GTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGA

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_1521nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTA
ACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAAT
TCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCA
ACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGC
TATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCA
AAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGAC
AACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTG
AAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGT
TCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGT
GTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGA

>In-frame_CPS1_ENST00000430249_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_1362nt
ATGCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACT
GCACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACT
AAGATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATT
ACTGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAA
CTGGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTG
GCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGG
GATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTT
TCAACCAAGGATGTCAAAGTGTACGGCAAAGGAAACCCCACAAAAGTGGTAGCTGTAGACTGTGGGATTAAAAACAATGTAATCCGCCTG
CTAGTAAAGCGAGGAGCTGAAGTGCACTTAGTTCCCTGGAACCATGATTTCACCAAGATGGAGTATGATGGGATTTTGATCGCGGGAGGA
CCGGGGAACCCAGCTCTTGCAGAACCACTAATTCAGAATGTCAGAAAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAG
TCCAGATGTGGTTCCAAGGATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTG
ACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAA
AAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTC
AGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTC
AGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAG

>In-frame_CPS1_ENST00000233072_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_1344nt
ATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAA
TTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCC
TTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAA
GGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATAT
TTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGG
CAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTT
GGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGATGTCAAA
GTGTACGGCAAAGGAAACCCCACAAAAGTGGTAGCTGTAGACTGTGGGATTAAAAACAATGTAATCCGCCTGCTAGTAAAGCGAGGAGCT
GAAGTGCACTTAGTTCCCTGGAACCATGATTTCACCAAGATGGAGTATGATGGGATTTTGATCGCGGGAGGACCGGGGAACCCAGCTCTT
GCAGAACCACTAATTCAGAATGTCAGAAAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTCCAGATGTGGTTCCAAG
GATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCT
CTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTT
GGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCC
CGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_1808nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAA
GCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCTCTCTCAACAG
TTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGG
GTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCA
CACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGACAACATCAAATACCAGCC
TAAAGGGGGGCAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTCCAGATGTGGTTCCAAGGATAACATCAAACATTC
GGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCA
CAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGC
TCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGC
TGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCT
CGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGAATATTTCTCATTTAGCATTGAAA
TAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCATTCTTTATAAACCATAAAATAAATAATCTCA

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_5315nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAA
GCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCTCTCTCAACAG
TTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGG
GTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCA
CACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGACAACATCAAATACCAGCC
TAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAG
GCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCA
TCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGA
GATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGA
ATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGAATATTTCTCATTTAGCATTGAAATAA
TAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCATTCTTTATAAACCATAAAATAAATAATCTCATCC
CCAAACTGTAGTAATTGTTACAATTTTCTATTTAAAAAATGAATAGTACATGCAGAAATTGACCTGATTTCCATTTGCAACAGGAAGACA
CTGGCTTTACATGGGTTCAATTGGACAATTATTTTTGCTCTGCTCTGTTTTGCATGGAGTATTATTATTTTAAAAATTGCATTTTTACCT
TTCATGTGCCTGAAGGCTATCCACTACATTCTGAAGGCCTTGTTAAAATCCAAGCTGCTCATTTCACTATTCTGTTTCTGAGTGAGAAGA
TAAAAACTGCCCATTGTAACTTATTTCAGGTTAAATTAAACCAAGGAGTCTGATTGCAGGAAGGGAAGAGCATGTAAGAAATAAGTTTTT
TTAAAGTGTTATTTTGTATAAATGGGAAGAAAGATTCAATTAAGTTATTAACATTTGGGACCTGGATAATTATATCAGAGTATGTCAGTC
CAATAAATTATTTAACTAATTAAAAAATAGTTGCAAAGCATTTGAGCTGTGGTTGAGGAAGTGGTGTAAAAGTGCATCCATTAGGAATGA
TGCACTTTCATTAGGATGGACTCGTGTCTGATTAGAATGTCAGTTGATCAGCTAGATTTGTGTCCACACTACCAGTTTCACACCCCCTTT
CCATCTGTTTGATACAGTATTATAGATATAAATATATATATATTTCTCTGTGGCCATTTGTGATACTTCCTCATATACTTGAATATTATA
CTTCTTTATTCACAGTATCTGTGTCTCCTGCACCCTTTGGTGTTGCAATTTTAGATATGTGAAAGTAGATGTTAGCAGGGTTCTCTCCCT
ATTTAAAAAAAATACATTAAAAAAGACAAAAAATTTTAGCATGAAGTTGCTTTCTGTAACAACTCAAAGCCGTAACCCTGTTTTAGTGCC
AGATACAAGTCTCTCCCGTGATGCTAGACAAAAAATTATTTTTCTTTGCTTTCACCAACATGGAGTTTGTGGGGGTGGGTCCAGTTATAC
ATGAAAGGGTTTACAGATTGTTGGTTTAAGATTATGGATTTATCTCATTTTTAATCACAGGATAGTTTGGGGTTTATTCCTATTATTATT
CATGAAACCGACTTAAGATTTTTTCTTTATTTTTCTTTTTTTTTCCATTTGCTAAAGTTGAAAGTTGAAACTAACTATAATAGTTTGAAA
CATGTTTTCTCATTTTTCCAAATAGTATCTGTTTATTAAATTCTCTAATAGAAGATGTTTGTCTTTCTTACCCAAAGTAAAGATCCCCTG
ATCAGAAAGAAAAAATACAATACTTTGGGAAGCTATAGCTATAAAACACTTGAGACACAGATATCTAAATCAGTTTTTTTCCAAGACTCC
AACATTGCACTCTGTAAAGTAACACACTGTGATCTAGTATTATTTATCAGTAGATAATACTGTTCTGACTGTATATACAGTCTAGAACTC
ACAAATCAATTAGTTCCTCTCACAAATCATTCATCTTAGACTTACAAATAAGGAATGAAATAGTCAATGGCCTGATTAAGGCAAAGAGCT
ACCAGGCTAGATGGACACTTTTTAAAAATTTTATCTGTTCTTTTTCTTGCTCAGGGCTGGTAGGTTGGATCTGAACCATTAAAATCAAAT
GGTCCACTAGGCGTATGATCTCTTTGAGCCAAATCAGTTCCTGAATATAAAGGAGGAAATGATGAGGATGTACTGAGGCAACGGGGAAGT
ATAGAAACATCCAAGACAAAAGCCAAGGGATGCAAAGGCAGAGACACAGGTGCTTTTTGGTGACCCAGTGGATATGGCAACCAGTGTAAC
TGCCATACAAGAAACCCTAGGAGCAAACCCACACCACTCATTCTCAGCTAAGAGATTTTACACAGGCAAACGTGTCTTAAACCATCTATA
AATCAGTTATTTTATATGACAGTCAAAACCTTAGAAACCTTAGGATCATTATATCTATTTTCTGCCTATTAATTGCTGTGAGGTTTGATT
TGACCAATCTGGGCAATTTATTCATCAGCTTCCCTTGAAGTGCACCAGAAAATAGAAGAAAGGTGTGTGGAGACTTAGGGTATTTTATTA
CATGTTTTCATAGTCTTAAATAGTGATTAAATTTCTCTAGAAAGAAGTTAACAGCTCATTAGAAAAGTTTTAACCTGTGAAATAAGTATT
TTTCTCAACATTCTTTAAAGTTTTTATATAAGTTAACACTAGGTAAACATTCTGCATACTAGAAGTCAGTTTATTACAAATACATGTCAA
AAATAAAGATTATACAAGGCACCAAACTACTAGATTTGGCATTAAAACAAATGTTTATTTCTAATCACAACAAAATTATAATGAATAAAT
GTTCTTGCTTTGTATGGAAATACAATTCTTTATTAAAGTTAACAGAAAGGAACTGATCGTTTGTACCAGTAAAAGAGAGAAACACACAGG
TTAAATATCTTCTTGTGGGGTTAAGGGGTAGAACCTATCTTGCCTTCACTCTCAAGATAACGACTCAAATTAAGCTTTTTGAGCACCACT
CTTGTGGGGACACACATACGCTGATCTAGGAATGAAATCTTCGTGGTCTCAATTCTAGATCTACTATGCCAGTTTCTCTCTGGCTTTAGC
CTTTGAGAACCTGTATAAGAATACGTAAGTAATCCAGAGCTGTGAAGAGTTTAAAGGCCAACTTCTCCAGTGAACTCAACCTCTGGGTCA
CTTGCAACCAGAAATTGGATACCTCATAATGATGCAGGAAAGACCCGAGTTCATGATGAGTTTCAAAGGCCACGTTCATTTAGGAACCAA
CTCTCTCTGGATTTACCTGCTGAGTTCCAGCAGCGTGATGGGCTGACATCCCACCTACAAGTATGACACCTGTGTAACACCAGCTAGGTA
CGGCTGGAGAAGGCTGAAGAGAGAATGCCATTAAATGGAAGAATGTACTGATTGTAGTGACCTTCTCCACACACACACACACACACACAC
ACACACACACCTACAGTAATACAGCAAGCGTGGAATAATCAGCCAATATATAACATTCCATCAGTATTTTATTAAGGAAATAACCTGAAT
GTGGTTGATTTTGACATAGCTGCAATTACAGTTTTCTTCTATTTTTCAAGCCACAATAAGGAAAATAAACTACTCATGGTCTAAATACTA
GAGATAAAGTAGATTCATGGCTTGGTAAGGAAATTTTAAGCATTCCTTCAAAGATTGACGTGCTAAAATAAGCATTGATGTTTTGAGTTT
TTTTACACCTAGGATTTTTAGCTTGGGTGTGTAGGTGAAGGCCAAGACTCTCTGCAGGAAAAAGCTTATTTTCAAACTCAGAAAATAAAA
TGTCAATCATAAAAATCTACTTCAACTTTAGCAAAAAGAAAAAAAAATCAACAAAAAGTATACTCTGTATGCTGGGATTCCGAGGTTCCA
ACACACTGTTACAAATCTGTGGGGGGTTTCTTTCTTCTGATAATTCTAGAGCCTGTTACCATAGAAAGGCATTTCTTCAATGGCTGGTTG
TAGTTAGTTCATGTTTTTCAATCAAATTTGCAAATGTATTTGTTGCTGTATAGTGATTGTTTTGCAAAATAAAATTGCTTGTCACCTAAC

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_1720nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAA
GCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCTCTCTCAACAG
TTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGG
GTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCA
CACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGACAACATCAAATACCAGCC
TAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAG
GCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCA
TCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGA
GATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGA
ATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGAATATTTCTCATTTAGCATTGAAATAA
TAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCATTCTTTATAAACCATAAAATAAATAATCTCATCC

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_5315nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAA
GCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCTCTCTCAACAG
TTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGG
GTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCA
CACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGACAACATCAAATACCAGCC
TAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAG
GCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCA
TCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGA
GATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGA
ATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGAATATTTCTCATTTAGCATTGAAATAA
TAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCATTCTTTATAAACCATAAAATAAATAATCTCATCC
CCAAACTGTAGTAATTGTTACAATTTTCTATTTAAAAAATGAATAGTACATGCAGAAATTGACCTGATTTCCATTTGCAACAGGAAGACA
CTGGCTTTACATGGGTTCAATTGGACAATTATTTTTGCTCTGCTCTGTTTTGCATGGAGTATTATTATTTTAAAAATTGCATTTTTACCT
TTCATGTGCCTGAAGGCTATCCACTACATTCTGAAGGCCTTGTTAAAATCCAAGCTGCTCATTTCACTATTCTGTTTCTGAGTGAGAAGA
TAAAAACTGCCCATTGTAACTTATTTCAGGTTAAATTAAACCAAGGAGTCTGATTGCAGGAAGGGAAGAGCATGTAAGAAATAAGTTTTT
TTAAAGTGTTATTTTGTATAAATGGGAAGAAAGATTCAATTAAGTTATTAACATTTGGGACCTGGATAATTATATCAGAGTATGTCAGTC
CAATAAATTATTTAACTAATTAAAAAATAGTTGCAAAGCATTTGAGCTGTGGTTGAGGAAGTGGTGTAAAAGTGCATCCATTAGGAATGA
TGCACTTTCATTAGGATGGACTCGTGTCTGATTAGAATGTCAGTTGATCAGCTAGATTTGTGTCCACACTACCAGTTTCACACCCCCTTT
CCATCTGTTTGATACAGTATTATAGATATAAATATATATATATTTCTCTGTGGCCATTTGTGATACTTCCTCATATACTTGAATATTATA
CTTCTTTATTCACAGTATCTGTGTCTCCTGCACCCTTTGGTGTTGCAATTTTAGATATGTGAAAGTAGATGTTAGCAGGGTTCTCTCCCT
ATTTAAAAAAAATACATTAAAAAAGACAAAAAATTTTAGCATGAAGTTGCTTTCTGTAACAACTCAAAGCCGTAACCCTGTTTTAGTGCC
AGATACAAGTCTCTCCCGTGATGCTAGACAAAAAATTATTTTTCTTTGCTTTCACCAACATGGAGTTTGTGGGGGTGGGTCCAGTTATAC
ATGAAAGGGTTTACAGATTGTTGGTTTAAGATTATGGATTTATCTCATTTTTAATCACAGGATAGTTTGGGGTTTATTCCTATTATTATT
CATGAAACCGACTTAAGATTTTTTCTTTATTTTTCTTTTTTTTTCCATTTGCTAAAGTTGAAAGTTGAAACTAACTATAATAGTTTGAAA
CATGTTTTCTCATTTTTCCAAATAGTATCTGTTTATTAAATTCTCTAATAGAAGATGTTTGTCTTTCTTACCCAAAGTAAAGATCCCCTG
ATCAGAAAGAAAAAATACAATACTTTGGGAAGCTATAGCTATAAAACACTTGAGACACAGATATCTAAATCAGTTTTTTTCCAAGACTCC
AACATTGCACTCTGTAAAGTAACACACTGTGATCTAGTATTATTTATCAGTAGATAATACTGTTCTGACTGTATATACAGTCTAGAACTC
ACAAATCAATTAGTTCCTCTCACAAATCATTCATCTTAGACTTACAAATAAGGAATGAAATAGTCAATGGCCTGATTAAGGCAAAGAGCT
ACCAGGCTAGATGGACACTTTTTAAAAATTTTATCTGTTCTTTTTCTTGCTCAGGGCTGGTAGGTTGGATCTGAACCATTAAAATCAAAT
GGTCCACTAGGCGTATGATCTCTTTGAGCCAAATCAGTTCCTGAATATAAAGGAGGAAATGATGAGGATGTACTGAGGCAACGGGGAAGT
ATAGAAACATCCAAGACAAAAGCCAAGGGATGCAAAGGCAGAGACACAGGTGCTTTTTGGTGACCCAGTGGATATGGCAACCAGTGTAAC
TGCCATACAAGAAACCCTAGGAGCAAACCCACACCACTCATTCTCAGCTAAGAGATTTTACACAGGCAAACGTGTCTTAAACCATCTATA
AATCAGTTATTTTATATGACAGTCAAAACCTTAGAAACCTTAGGATCATTATATCTATTTTCTGCCTATTAATTGCTGTGAGGTTTGATT
TGACCAATCTGGGCAATTTATTCATCAGCTTCCCTTGAAGTGCACCAGAAAATAGAAGAAAGGTGTGTGGAGACTTAGGGTATTTTATTA
CATGTTTTCATAGTCTTAAATAGTGATTAAATTTCTCTAGAAAGAAGTTAACAGCTCATTAGAAAAGTTTTAACCTGTGAAATAAGTATT
TTTCTCAACATTCTTTAAAGTTTTTATATAAGTTAACACTAGGTAAACATTCTGCATACTAGAAGTCAGTTTATTACAAATACATGTCAA
AAATAAAGATTATACAAGGCACCAAACTACTAGATTTGGCATTAAAACAAATGTTTATTTCTAATCACAACAAAATTATAATGAATAAAT
GTTCTTGCTTTGTATGGAAATACAATTCTTTATTAAAGTTAACAGAAAGGAACTGATCGTTTGTACCAGTAAAAGAGAGAAACACACAGG
TTAAATATCTTCTTGTGGGGTTAAGGGGTAGAACCTATCTTGCCTTCACTCTCAAGATAACGACTCAAATTAAGCTTTTTGAGCACCACT
CTTGTGGGGACACACATACGCTGATCTAGGAATGAAATCTTCGTGGTCTCAATTCTAGATCTACTATGCCAGTTTCTCTCTGGCTTTAGC
CTTTGAGAACCTGTATAAGAATACGTAAGTAATCCAGAGCTGTGAAGAGTTTAAAGGCCAACTTCTCCAGTGAACTCAACCTCTGGGTCA
CTTGCAACCAGAAATTGGATACCTCATAATGATGCAGGAAAGACCCGAGTTCATGATGAGTTTCAAAGGCCACGTTCATTTAGGAACCAA
CTCTCTCTGGATTTACCTGCTGAGTTCCAGCAGCGTGATGGGCTGACATCCCACCTACAAGTATGACACCTGTGTAACACCAGCTAGGTA
CGGCTGGAGAAGGCTGAAGAGAGAATGCCATTAAATGGAAGAATGTACTGATTGTAGTGACCTTCTCCACACACACACACACACACACAC
ACACACACACCTACAGTAATACAGCAAGCGTGGAATAATCAGCCAATATATAACATTCCATCAGTATTTTATTAAGGAAATAACCTGAAT
GTGGTTGATTTTGACATAGCTGCAATTACAGTTTTCTTCTATTTTTCAAGCCACAATAAGGAAAATAAACTACTCATGGTCTAAATACTA
GAGATAAAGTAGATTCATGGCTTGGTAAGGAAATTTTAAGCATTCCTTCAAAGATTGACGTGCTAAAATAAGCATTGATGTTTTGAGTTT
TTTTACACCTAGGATTTTTAGCTTGGGTGTGTAGGTGAAGGCCAAGACTCTCTGCAGGAAAAAGCTTATTTTCAAACTCAGAAAATAAAA
TGTCAATCATAAAAATCTACTTCAACTTTAGCAAAAAGAAAAAAAAATCAACAAAAAGTATACTCTGTATGCTGGGATTCCGAGGTTCCA
ACACACTGTTACAAATCTGTGGGGGGTTTCTTTCTTCTGATAATTCTAGAGCCTGTTACCATAGAAAGGCATTTCTTCAATGGCTGGTTG
TAGTTAGTTCATGTTTTTCAATCAAATTTGCAAATGTATTTGTTGCTGTATAGTGATTGTTTTGCAAAATAAAATTGCTTGTCACCTAAC

>In-frame_CPS1_ENST00000430249_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_1594nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGACGGAGTAACCAAGAGCCCAGAAAA
GCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCTCTCTCAACAG
TTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGG
GTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCA
CACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACAGACAACATCAAATACCAGCC
TAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAG
GCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCA
TCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGA
GATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGA

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000199940_chr2_210570304_+_1931nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGG
AGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGG
GAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCAC
TCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCAT
CATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAA
AATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTC
CAGATGTGGTTCCAAGGATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGAC
ATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAA
GGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAG
AGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAG
CAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCA
GGGCTTGTGAATATTTCTCATTTAGCATTGAAATAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATT

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000360351_chr2_210570304_+_5438nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGG
AGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGG
GAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCAC
TCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCAT
CATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAA
AATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATC
CAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGC
CCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGA
GCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAA
TGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGG
CTTGTGAATATTTCTCATTTAGCATTGAAATAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCAT
TCTTTATAAACCATAAAATAAATAATCTCATCCCCAAACTGTAGTAATTGTTACAATTTTCTATTTAAAAAATGAATAGTACATGCAGAA
ATTGACCTGATTTCCATTTGCAACAGGAAGACACTGGCTTTACATGGGTTCAATTGGACAATTATTTTTGCTCTGCTCTGTTTTGCATGG
AGTATTATTATTTTAAAAATTGCATTTTTACCTTTCATGTGCCTGAAGGCTATCCACTACATTCTGAAGGCCTTGTTAAAATCCAAGCTG
CTCATTTCACTATTCTGTTTCTGAGTGAGAAGATAAAAACTGCCCATTGTAACTTATTTCAGGTTAAATTAAACCAAGGAGTCTGATTGC
AGGAAGGGAAGAGCATGTAAGAAATAAGTTTTTTTAAAGTGTTATTTTGTATAAATGGGAAGAAAGATTCAATTAAGTTATTAACATTTG
GGACCTGGATAATTATATCAGAGTATGTCAGTCCAATAAATTATTTAACTAATTAAAAAATAGTTGCAAAGCATTTGAGCTGTGGTTGAG
GAAGTGGTGTAAAAGTGCATCCATTAGGAATGATGCACTTTCATTAGGATGGACTCGTGTCTGATTAGAATGTCAGTTGATCAGCTAGAT
TTGTGTCCACACTACCAGTTTCACACCCCCTTTCCATCTGTTTGATACAGTATTATAGATATAAATATATATATATTTCTCTGTGGCCAT
TTGTGATACTTCCTCATATACTTGAATATTATACTTCTTTATTCACAGTATCTGTGTCTCCTGCACCCTTTGGTGTTGCAATTTTAGATA
TGTGAAAGTAGATGTTAGCAGGGTTCTCTCCCTATTTAAAAAAAATACATTAAAAAAGACAAAAAATTTTAGCATGAAGTTGCTTTCTGT
AACAACTCAAAGCCGTAACCCTGTTTTAGTGCCAGATACAAGTCTCTCCCGTGATGCTAGACAAAAAATTATTTTTCTTTGCTTTCACCA
ACATGGAGTTTGTGGGGGTGGGTCCAGTTATACATGAAAGGGTTTACAGATTGTTGGTTTAAGATTATGGATTTATCTCATTTTTAATCA
CAGGATAGTTTGGGGTTTATTCCTATTATTATTCATGAAACCGACTTAAGATTTTTTCTTTATTTTTCTTTTTTTTTCCATTTGCTAAAG
TTGAAAGTTGAAACTAACTATAATAGTTTGAAACATGTTTTCTCATTTTTCCAAATAGTATCTGTTTATTAAATTCTCTAATAGAAGATG
TTTGTCTTTCTTACCCAAAGTAAAGATCCCCTGATCAGAAAGAAAAAATACAATACTTTGGGAAGCTATAGCTATAAAACACTTGAGACA
CAGATATCTAAATCAGTTTTTTTCCAAGACTCCAACATTGCACTCTGTAAAGTAACACACTGTGATCTAGTATTATTTATCAGTAGATAA
TACTGTTCTGACTGTATATACAGTCTAGAACTCACAAATCAATTAGTTCCTCTCACAAATCATTCATCTTAGACTTACAAATAAGGAATG
AAATAGTCAATGGCCTGATTAAGGCAAAGAGCTACCAGGCTAGATGGACACTTTTTAAAAATTTTATCTGTTCTTTTTCTTGCTCAGGGC
TGGTAGGTTGGATCTGAACCATTAAAATCAAATGGTCCACTAGGCGTATGATCTCTTTGAGCCAAATCAGTTCCTGAATATAAAGGAGGA
AATGATGAGGATGTACTGAGGCAACGGGGAAGTATAGAAACATCCAAGACAAAAGCCAAGGGATGCAAAGGCAGAGACACAGGTGCTTTT
TGGTGACCCAGTGGATATGGCAACCAGTGTAACTGCCATACAAGAAACCCTAGGAGCAAACCCACACCACTCATTCTCAGCTAAGAGATT
TTACACAGGCAAACGTGTCTTAAACCATCTATAAATCAGTTATTTTATATGACAGTCAAAACCTTAGAAACCTTAGGATCATTATATCTA
TTTTCTGCCTATTAATTGCTGTGAGGTTTGATTTGACCAATCTGGGCAATTTATTCATCAGCTTCCCTTGAAGTGCACCAGAAAATAGAA
GAAAGGTGTGTGGAGACTTAGGGTATTTTATTACATGTTTTCATAGTCTTAAATAGTGATTAAATTTCTCTAGAAAGAAGTTAACAGCTC
ATTAGAAAAGTTTTAACCTGTGAAATAAGTATTTTTCTCAACATTCTTTAAAGTTTTTATATAAGTTAACACTAGGTAAACATTCTGCAT
ACTAGAAGTCAGTTTATTACAAATACATGTCAAAAATAAAGATTATACAAGGCACCAAACTACTAGATTTGGCATTAAAACAAATGTTTA
TTTCTAATCACAACAAAATTATAATGAATAAATGTTCTTGCTTTGTATGGAAATACAATTCTTTATTAAAGTTAACAGAAAGGAACTGAT
CGTTTGTACCAGTAAAAGAGAGAAACACACAGGTTAAATATCTTCTTGTGGGGTTAAGGGGTAGAACCTATCTTGCCTTCACTCTCAAGA
TAACGACTCAAATTAAGCTTTTTGAGCACCACTCTTGTGGGGACACACATACGCTGATCTAGGAATGAAATCTTCGTGGTCTCAATTCTA
GATCTACTATGCCAGTTTCTCTCTGGCTTTAGCCTTTGAGAACCTGTATAAGAATACGTAAGTAATCCAGAGCTGTGAAGAGTTTAAAGG
CCAACTTCTCCAGTGAACTCAACCTCTGGGTCACTTGCAACCAGAAATTGGATACCTCATAATGATGCAGGAAAGACCCGAGTTCATGAT
GAGTTTCAAAGGCCACGTTCATTTAGGAACCAACTCTCTCTGGATTTACCTGCTGAGTTCCAGCAGCGTGATGGGCTGACATCCCACCTA
CAAGTATGACACCTGTGTAACACCAGCTAGGTACGGCTGGAGAAGGCTGAAGAGAGAATGCCATTAAATGGAAGAATGTACTGATTGTAG
TGACCTTCTCCACACACACACACACACACACACACACACACACCTACAGTAATACAGCAAGCGTGGAATAATCAGCCAATATATAACATT
CCATCAGTATTTTATTAAGGAAATAACCTGAATGTGGTTGATTTTGACATAGCTGCAATTACAGTTTTCTTCTATTTTTCAAGCCACAAT
AAGGAAAATAAACTACTCATGGTCTAAATACTAGAGATAAAGTAGATTCATGGCTTGGTAAGGAAATTTTAAGCATTCCTTCAAAGATTG
ACGTGCTAAAATAAGCATTGATGTTTTGAGTTTTTTTACACCTAGGATTTTTAGCTTGGGTGTGTAGGTGAAGGCCAAGACTCTCTGCAG
GAAAAAGCTTATTTTCAAACTCAGAAAATAAAATGTCAATCATAAAAATCTACTTCAACTTTAGCAAAAAGAAAAAAAAATCAACAAAAA
GTATACTCTGTATGCTGGGATTCCGAGGTTCCAACACACTGTTACAAATCTGTGGGGGGTTTCTTTCTTCTGATAATTCTAGAGCCTGTT
ACCATAGAAAGGCATTTCTTCAATGGCTGGTTGTAGTTAGTTCATGTTTTTCAATCAAATTTGCAAATGTATTTGTTGCTGTATAGTGAT

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000361559_chr2_210570304_+_1843nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGG
AGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGG
GAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCAC
TCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCAT
CATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAA
AATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATC
CAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGC
CCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGA
GCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAA
TGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGG
CTTGTGAATATTTCTCATTTAGCATTGAAATAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCAT

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000392194_chr2_210570304_+_5438nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGG
AGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGG
GAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCAC
TCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCAT
CATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAA
AATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATC
CAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGC
CCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGA
GCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAA
TGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGG
CTTGTGAATATTTCTCATTTAGCATTGAAATAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCAT
TCTTTATAAACCATAAAATAAATAATCTCATCCCCAAACTGTAGTAATTGTTACAATTTTCTATTTAAAAAATGAATAGTACATGCAGAA
ATTGACCTGATTTCCATTTGCAACAGGAAGACACTGGCTTTACATGGGTTCAATTGGACAATTATTTTTGCTCTGCTCTGTTTTGCATGG
AGTATTATTATTTTAAAAATTGCATTTTTACCTTTCATGTGCCTGAAGGCTATCCACTACATTCTGAAGGCCTTGTTAAAATCCAAGCTG
CTCATTTCACTATTCTGTTTCTGAGTGAGAAGATAAAAACTGCCCATTGTAACTTATTTCAGGTTAAATTAAACCAAGGAGTCTGATTGC
AGGAAGGGAAGAGCATGTAAGAAATAAGTTTTTTTAAAGTGTTATTTTGTATAAATGGGAAGAAAGATTCAATTAAGTTATTAACATTTG
GGACCTGGATAATTATATCAGAGTATGTCAGTCCAATAAATTATTTAACTAATTAAAAAATAGTTGCAAAGCATTTGAGCTGTGGTTGAG
GAAGTGGTGTAAAAGTGCATCCATTAGGAATGATGCACTTTCATTAGGATGGACTCGTGTCTGATTAGAATGTCAGTTGATCAGCTAGAT
TTGTGTCCACACTACCAGTTTCACACCCCCTTTCCATCTGTTTGATACAGTATTATAGATATAAATATATATATATTTCTCTGTGGCCAT
TTGTGATACTTCCTCATATACTTGAATATTATACTTCTTTATTCACAGTATCTGTGTCTCCTGCACCCTTTGGTGTTGCAATTTTAGATA
TGTGAAAGTAGATGTTAGCAGGGTTCTCTCCCTATTTAAAAAAAATACATTAAAAAAGACAAAAAATTTTAGCATGAAGTTGCTTTCTGT
AACAACTCAAAGCCGTAACCCTGTTTTAGTGCCAGATACAAGTCTCTCCCGTGATGCTAGACAAAAAATTATTTTTCTTTGCTTTCACCA
ACATGGAGTTTGTGGGGGTGGGTCCAGTTATACATGAAAGGGTTTACAGATTGTTGGTTTAAGATTATGGATTTATCTCATTTTTAATCA
CAGGATAGTTTGGGGTTTATTCCTATTATTATTCATGAAACCGACTTAAGATTTTTTCTTTATTTTTCTTTTTTTTTCCATTTGCTAAAG
TTGAAAGTTGAAACTAACTATAATAGTTTGAAACATGTTTTCTCATTTTTCCAAATAGTATCTGTTTATTAAATTCTCTAATAGAAGATG
TTTGTCTTTCTTACCCAAAGTAAAGATCCCCTGATCAGAAAGAAAAAATACAATACTTTGGGAAGCTATAGCTATAAAACACTTGAGACA
CAGATATCTAAATCAGTTTTTTTCCAAGACTCCAACATTGCACTCTGTAAAGTAACACACTGTGATCTAGTATTATTTATCAGTAGATAA
TACTGTTCTGACTGTATATACAGTCTAGAACTCACAAATCAATTAGTTCCTCTCACAAATCATTCATCTTAGACTTACAAATAAGGAATG
AAATAGTCAATGGCCTGATTAAGGCAAAGAGCTACCAGGCTAGATGGACACTTTTTAAAAATTTTATCTGTTCTTTTTCTTGCTCAGGGC
TGGTAGGTTGGATCTGAACCATTAAAATCAAATGGTCCACTAGGCGTATGATCTCTTTGAGCCAAATCAGTTCCTGAATATAAAGGAGGA
AATGATGAGGATGTACTGAGGCAACGGGGAAGTATAGAAACATCCAAGACAAAAGCCAAGGGATGCAAAGGCAGAGACACAGGTGCTTTT
TGGTGACCCAGTGGATATGGCAACCAGTGTAACTGCCATACAAGAAACCCTAGGAGCAAACCCACACCACTCATTCTCAGCTAAGAGATT
TTACACAGGCAAACGTGTCTTAAACCATCTATAAATCAGTTATTTTATATGACAGTCAAAACCTTAGAAACCTTAGGATCATTATATCTA
TTTTCTGCCTATTAATTGCTGTGAGGTTTGATTTGACCAATCTGGGCAATTTATTCATCAGCTTCCCTTGAAGTGCACCAGAAAATAGAA
GAAAGGTGTGTGGAGACTTAGGGTATTTTATTACATGTTTTCATAGTCTTAAATAGTGATTAAATTTCTCTAGAAAGAAGTTAACAGCTC
ATTAGAAAAGTTTTAACCTGTGAAATAAGTATTTTTCTCAACATTCTTTAAAGTTTTTATATAAGTTAACACTAGGTAAACATTCTGCAT
ACTAGAAGTCAGTTTATTACAAATACATGTCAAAAATAAAGATTATACAAGGCACCAAACTACTAGATTTGGCATTAAAACAAATGTTTA
TTTCTAATCACAACAAAATTATAATGAATAAATGTTCTTGCTTTGTATGGAAATACAATTCTTTATTAAAGTTAACAGAAAGGAACTGAT
CGTTTGTACCAGTAAAAGAGAGAAACACACAGGTTAAATATCTTCTTGTGGGGTTAAGGGGTAGAACCTATCTTGCCTTCACTCTCAAGA
TAACGACTCAAATTAAGCTTTTTGAGCACCACTCTTGTGGGGACACACATACGCTGATCTAGGAATGAAATCTTCGTGGTCTCAATTCTA
GATCTACTATGCCAGTTTCTCTCTGGCTTTAGCCTTTGAGAACCTGTATAAGAATACGTAAGTAATCCAGAGCTGTGAAGAGTTTAAAGG
CCAACTTCTCCAGTGAACTCAACCTCTGGGTCACTTGCAACCAGAAATTGGATACCTCATAATGATGCAGGAAAGACCCGAGTTCATGAT
GAGTTTCAAAGGCCACGTTCATTTAGGAACCAACTCTCTCTGGATTTACCTGCTGAGTTCCAGCAGCGTGATGGGCTGACATCCCACCTA
CAAGTATGACACCTGTGTAACACCAGCTAGGTACGGCTGGAGAAGGCTGAAGAGAGAATGCCATTAAATGGAAGAATGTACTGATTGTAG
TGACCTTCTCCACACACACACACACACACACACACACACACACCTACAGTAATACAGCAAGCGTGGAATAATCAGCCAATATATAACATT
CCATCAGTATTTTATTAAGGAAATAACCTGAATGTGGTTGATTTTGACATAGCTGCAATTACAGTTTTCTTCTATTTTTCAAGCCACAAT
AAGGAAAATAAACTACTCATGGTCTAAATACTAGAGATAAAGTAGATTCATGGCTTGGTAAGGAAATTTTAAGCATTCCTTCAAAGATTG
ACGTGCTAAAATAAGCATTGATGTTTTGAGTTTTTTTACACCTAGGATTTTTAGCTTGGGTGTGTAGGTGAAGGCCAAGACTCTCTGCAG
GAAAAAGCTTATTTTCAAACTCAGAAAATAAAATGTCAATCATAAAAATCTACTTCAACTTTAGCAAAAAGAAAAAAAAATCAACAAAAA
GTATACTCTGTATGCTGGGATTCCGAGGTTCCAACACACTGTTACAAATCTGTGGGGGGTTTCTTTCTTCTGATAATTCTAGAGCCTGTT
ACCATAGAAAGGCATTTCTTCAATGGCTGGTTGTAGTTAGTTCATGTTTTTCAATCAAATTTGCAAATGTATTTGTTGCTGTATAGTGAT

>In-frame_CPS1_ENST00000233072_chr2_211447433_+_MAP2_ENST00000447185_chr2_210570304_+_1717nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGG
AGACAGAGATGAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGG
GAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCAC
TCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCAT
CATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAA
AATCGGATCAACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATC
CAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGC
CCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGA
GCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAA
TGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGG

>In-frame_CPS1_ENST00000430249_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_1538nt
GAAATGTAGTTGCTTTCTTAACCTCATCAAATTCATGAAGATTTAGCCGAGGCCCATGCCACAAATCATCAAAATGACGAGGATTTTGAC
AGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGCACACCAAAAATGGAAATTTTCAAGACCTGGCAT
CAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAAGATGAAAGGTTACTCCTTTGGCCATCCATCCTC
TGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTACTGACCCTGCCTACAAAGGACAGATTCTCACAAT
GGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACTGGGACTTAGCAAATATTTGGAGTCTAATGGAAT
CAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGCTACCAAGAGTTTAGGGCAATGGCTACAGGAAGA
AAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGA
AGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTCAACCAAGGATGTCAAAGTGTACGGCAAAGGAAA
CCCCACAAAAGTGGTAGCTGTAGACTGTGGGATTAAAAACAATGTAATCCGCCTGCTAGTAAAGCGAGGAGCTGAAGTGCACTTAGTTCC
CTGGAACCATGATTTCACCAAGATGGAGTATGATGGGATTTTGATCGCGGGAGGACCGGGGAACCCAGCTCTTGCAGAACCACTAATTCA
GAATGTCAGAAAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTCCAGATGTGGTTCCAAGGATAACATCAAACATTC
GGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGTGGCTCTCTGAAGAACATCCGCCA
CAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGC
TCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACCATGGGGC
TGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCT
CGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGAATATTTCTCATTTAGCATTGAAA
TAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATTCATTCTTTATAAACCATAAAATAAATAATCTCA

>In-frame_CPS1_ENST00000233072_chr2_211454958_+_MAP2_ENST00000199940_chr2_210588319_+_1661nt
GGGGTTAAGAGAAGGAGGAGCTGTGGCTGAAGACATTTAATGGCAGAATGAATGGAAATTCAAAGATCGCTGTGCAGTCAGCCTTAAACA
CTGACTGCACCCCTCCCAGATTTCTTTTACATTAACTAAAAAGTCTTATCACACAATCTCATAAAATTTATGTAATTTCATTTAATTTTA
GCCACAAATCATCAAAATGACGAGGATTTTGACAGCTTTCAAAGTGGTGAGGACACTGAAGACTGGTTTTGGCTTTACCAATGTGACTGC
ACACCAAAAATGGAAATTTTCAAGACCTGGCATCAGGCTCCTTTCTGTCAAGGCACAGACAGCACACATTGTCCTGGAAGATGGAACTAA
GATGAAAGGTTACTCCTTTGGCCATCCATCCTCTGTTGCTGGTGAAGTGGTTTTTAATACTGGCCTGGGAGGGTACCCAGAAGCTATTAC
TGACCCTGCCTACAAAGGACAGATTCTCACAATGGCCAACCCTATTATTGGGAATGGTGGAGCTCCTGATACTACTGCTCTGGATGAACT
GGGACTTAGCAAATATTTGGAGTCTAATGGAATCAAGGTTTCAGGTTTGCTGGTGCTGGATTATAGTAAAGACTACAACCACTGGCTGGC
TACCAAGAGTTTAGGGCAATGGCTACAGGAAGAAAAGGTTCCTGCAATTTATGGAGTGGACACAAGAATGCTGACTAAAATAATTCGGGA
TAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGGTCAGCCTGTGGATTTTGTGGATCCAAATAAACAGAATTTGATTGCTGAGGTTTC
AACCAAGGATGTCAAAGTGTACGGCAAAGGAAACCCCACAAAAGTGGTAGCTGTAGACTGTGGGATTAAAAACAATGTAATCCGCCTGCT
AGTAAAGCGAGGAGCTGAAGTGCACTTAGTTCCCTGGAACCATGATTTCACCAAGATGGAGTATGATGGGATTTTGATCGCGGGAGGACC
GGGGAACCCAGCTCTTGCAGAACCACTAATTCAGAATGTCAGAAAGGTTAGGATTTTAAACAAGAAGATCGATTTTAGCAAAGTTCAGTC
CAGATGTGGTTCCAAGGATAACATCAAACATTCGGCTGGGGGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGAC
ATCCAAATGTGGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTAAAACTAGATTTCAAAGAAAA
GGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAG
AGAGCATGCTAAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAG
CAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCA
GGGCTTGTGAATATTTCTCATTTAGCATTGAAATAATAATATTTAGGCATGAGCTCTTGGCAGGAGTGGGCTCTGAGCAGTTGTTATATT


Top

FusionGenePPI for CPS1_MAP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CPS1H2AFX, YWHAQ, RICTOR, RAD21, ELAVL1, MYC, FH, SEC22B, CPT1A, MRPS26, HSPA9, LRPPRC, TOMM70A, PCBP1, HSPA1A, ARAF, FBXO6, ASB1, AGO2, ARHGEF26, KIRREL2, RARS2, THBS3, HNRNPH1, HSPA4, HSPA8, HSPH1, HSPA5, DNAJC7, TUBG1, XRCC3, AP1S2, TUBA1C, ARMC6, TCF4, FOXF1, FOXG1, HSD17B10, C2orf47, UBC, KRT1, ALB, LMO2, DEFB121, BPNT1, YBEY, NDUFS7, ACSM5, TMEM70, FOXRED1, DKKL1, OTC, TESMAP2MARK4, SRC, GRB2, FYN, NEFL, MYO7A, MAP2, PLEC, NEDD4L, NEDD4, DAG1, TUBA1A, MARK3, ACTN1, RAE1, APP, ACTB, JUNB, HECW2, DHX9, DYNC1I2, HNRNPA0, IGF2BP3, ABCF1, DIMT1, EIF3C, EIF3K, NMT1, PA2G4, YBX1, PSMC5, PSMD13, PSMD8, RPL23A, ARMC1, HAX1, NUFIP1, DGUOK, PRKAR2B, NTRK1, DCTN1, MDM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneMAP2chr2:211447433chr2:210570304ENST00000199940+815701_744229560KNDC1
TgeneMAP2chr2:211447433chr2:210570304ENST00000361559+612701_744172472KNDC1
TgeneMAP2chr2:211447433chr2:210570304ENST00000392194+511701_744172472KNDC1
TgeneMAP2chr2:211454958chr2:210588319ENST00000199940+1015701_744392560KNDC1
TgeneMAP2chr2:211454958chr2:210588319ENST00000360351+015701_744-1691828KNDC1
TgeneMAP2chr2:211454958chr2:210588319ENST00000361559+012701_744-166472KNDC1
TgeneMAP2chr2:211454958chr2:210588319ENST00000392194+011701_744-56472KNDC1
TgeneMAP2chr2:211454958chr2:210588319ENST00000447185+012701_74401824KNDC1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneMAP2chr2:211447433chr2:210570304ENST00000360351+915701_74415281828KNDC1
TgeneMAP2chr2:211447433chr2:210570304ENST00000447185+612701_74415241824KNDC1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CPS1_MAP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCPS1P31327DB06775Carglumic AcidCarbamoyl-phosphate synthase [ammonia], mitochondrialsmall moleculeapproved
TgeneMAP2P11137DB01196EstramustineMicrotubule-associated protein 2small moleculeapproved|investigational
TgeneMAP2P11137DB01248DocetaxelMicrotubule-associated protein 2small moleculeapproved|investigational
TgeneMAP2P11137DB01229PaclitaxelMicrotubule-associated protein 2small moleculeapproved|vet_approved

Top

RelatedDiseases for CPS1_MAP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCPS1C4082171Hyperammonemia Due to Carbamoyl Phosphate Synthetase 1 Deficiency10ORPHANET;UNIPROT
HgeneCPS1C0220994Hyperammonemia2CTD_human;HPO
HgeneCPS1C0751753Carbamoyl-Phosphate Synthase I Deficiency Disease2CTD_human;ORPHANET
HgeneCPS1C0009421Comatose1CTD_human;HPO
HgeneCPS1C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneCPS1C0031190Persistent Fetal Circulation Syndrome1CTD_human
HgeneCPS1C0032927Precancerous Conditions1CTD_human
HgeneCPS1C0376618Endotoxemia1CTD_human
TgeneMAP2C0000786Spontaneous abortion1CTD_human
TgeneMAP2C0005586Bipolar Disorder1PSYGENET
TgeneMAP2C0036341Schizophrenia1PSYGENET
TgeneMAP2C0041696Unipolar Depression1PSYGENET
TgeneMAP2C0525045Mood Disorders1PSYGENET
TgeneMAP2C1269683Major Depressive Disorder1PSYGENET
TgeneMAP2C3495559Juvenile arthritis1CTD_human