FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8249

FusionGeneSummary for CPM_CCT2

check button Fusion gene summary
Fusion gene informationFusion gene name: CPM_CCT2
Fusion gene ID: 8249
HgeneTgene
Gene symbol

CPM

CCT2

Gene ID

1368

10576

Gene namecarboxypeptidase Mchaperonin containing TCP1 subunit 2
Synonyms-99D8.1|CCT-beta|CCTB|HEL-S-100n|PRO1633|TCP-1-beta
Cytomap

12q15

12q15

Type of geneprotein-codingprotein-coding
Descriptioncarboxypeptidase Mrenal carboxypeptidaseurinary carboxypeptidase BT-complex protein 1 subunit betaT-complex protein 1, beta subunitchaperonin containing TCP1, subunit 2 (beta)chaperonin containing t-complex polypeptide 1, beta subunitchaperonin containing t-complex polypeptide 1, subunit 2epididymis secretory sperm
Modification date2018052320180523
UniProtAcc

P14384

P78371

Ensembl transtripts involved in fusion geneENST00000546373, ENST00000551568, 
ENST00000338356, ENST00000549691, 
ENST00000299300, ENST00000544368, 
ENST00000543146, 
Fusion gene scores* DoF score12 X 5 X 6=36010 X 8 X 5=400
# samples 1210
** MAII scorelog2(12/360*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/400*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CPM [Title/Abstract] AND CCT2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1KU-01ACPMchr12

69279572

-CCT2chr12

69986756

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000546373ENST00000299300CPMchr12

69279572

-CCT2chr12

69986756

+
Frame-shitENST00000546373ENST00000544368CPMchr12

69279572

-CCT2chr12

69986756

+
Frame-shitENST00000546373ENST00000543146CPMchr12

69279572

-CCT2chr12

69986756

+
Frame-shitENST00000551568ENST00000299300CPMchr12

69279572

-CCT2chr12

69986756

+
Frame-shitENST00000551568ENST00000544368CPMchr12

69279572

-CCT2chr12

69986756

+
Frame-shitENST00000551568ENST00000543146CPMchr12

69279572

-CCT2chr12

69986756

+
In-frameENST00000338356ENST00000299300CPMchr12

69279572

-CCT2chr12

69986756

+
In-frameENST00000338356ENST00000544368CPMchr12

69279572

-CCT2chr12

69986756

+
In-frameENST00000338356ENST00000543146CPMchr12

69279572

-CCT2chr12

69986756

+
intron-3CDSENST00000549691ENST00000299300CPMchr12

69279572

-CCT2chr12

69986756

+
intron-3CDSENST00000549691ENST00000544368CPMchr12

69279572

-CCT2chr12

69986756

+
intron-3CDSENST00000549691ENST00000543146CPMchr12

69279572

-CCT2chr12

69986756

+

Top

FusionProtFeatures for CPM_CCT2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CPM

P14384

CCT2

P78371

Specifically removes C-terminal basic residues (Arg orLys) from peptides and proteins. It is believed to play importantroles in the control of peptide hormone and growth factor activityat the cell surface, and in the membrane-localized degradation ofextracellular proteins. {ECO:0000269|PubMed:12457462}. Molecular chaperone; assists the folding of proteinsupon ATP hydrolysis. As part of the BBS/CCT complex may play arole in the assembly of BBSome, a complex involved in ciliogenesisregulating transports vesicles to the cilia. Known to play a role,in vitro, in the folding of actin and tubulin.{ECO:0000269|PubMed:20080638}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CPM_CCT2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000299300_chr12_69986756_+_372aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDEIFGS
RVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLITNTPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLG
SCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVTGGGCSEMLMAHAVTQLANRTPGKEAV
AMESTAKALRMLPTIIADNAGTDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAA

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000544368_chr12_69986756_+_367aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDEIFGS
RVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLITNTPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLG
SCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVTGGGCSEMLMAHAVTQLANRTPGKEAV
AMESTAKALRMLPTIIADNAGTDSADLVAQLRAAHSEGNTTAGLGNVSLITTPVKHSHVLSIFGPVSSKVVFERYSIKEDCGICLSVPII

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000543146_chr12_69986756_+_372aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDEIFGS
RVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLITNTPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLG
SCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVTGGGCSEMLMAHAVTQLANRTPGKEAV
AMESTAKALRMLPTIIADNAGTDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000299300_chr12_69986756_+_1116nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTT
GTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAGAGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCC
CGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAACATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAG
CATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATTATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCAT
GCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTGGTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGA
AGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAACTCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTT
TTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGATCATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCT
AGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTCATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTT
GCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCATCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAG
CTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGGATATGAGGGAAGGCACCATTGGAGATATGGCTATCCTGGGTATAACA
GAAAGTTTTCAAGTGAAGCGACAGGTTCTTCTGAGTGCAGCTGAAGCAGCAGAGGTGATTCTGCGTGTGGACAACATCATCAAAGCGGCA

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000544368_chr12_69986756_+_1101nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTT
GTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAGAGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCC
CGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAACATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAG
CATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATTATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCAT
GCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTGGTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGA
AGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAACTCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTT
TTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGATCATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCT
AGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTCATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTT
GCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCATCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAG
CTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGGGAAACGTGTCCCTGATCACCACCCCTGTTAAGCATTCCCACGTGCTG
TCGATCTTTGGACCAGTTTCTAGCAAAGTTGTGTTTGAAAGATACTCTATTAAAGAAGACTGTGGAATCTGTTTATCGGTGCCCATTATA

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000543146_chr12_69986756_+_1116nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTT
GTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAGAGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCC
CGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAACATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAG
CATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATTATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCAT
GCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTGGTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGA
AGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAACTCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTT
TTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGATCATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCT
AGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTCATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTT
GCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCATCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAG
CTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGGATATGAGGGAAGGCACCATTGGAGATATGGCTATCCTGGGTATAACA
GAAAGTTTTCAAGTGAAGCGACAGGTTCTTCTGAGTGCAGCTGAAGCAGCAGAGGTGATTCTGCGTGTGGACAACATCATCAAAGCGGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000299300_chr12_69986756_+_1408nt
CCCTCATGTGTTCTCAGGTTCTTCTTATTTTTATTCATCTCTAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGG
TAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACT
TACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTTGTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAG
AGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCCCGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAAC
ATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAGCATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATT
ATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCATGCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTG
GTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGAAGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAAC
TCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTTTTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGAT
CATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCTAGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTC
ATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTTGCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCA
TCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAGCTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGG
ATATGAGGGAAGGCACCATTGGAGATATGGCTATCCTGGGTATAACAGAAAGTTTTCAAGTGAAGCGACAGGTTCTTCTGAGTGCAGCTG
AAGCAGCAGAGGTGATTCTGCGTGTGGACAACATCATCAAAGCGGCACCCAGGAAACGTGTCCCTGATCACCACCCCTGTTAAGCATTCC
CACGTGCTGTCGATCTTTGGACCAGTTTCTAGCAAAGTTGTGTTTGAAAGATACTCTATTAAAGAAGACTGTGGAATCTGTTTATCGGTG
CCCATTATATCCTTAAGTTTGGATATTTAGCTGACCTTCGCTTTAACATAGGTCTAATTTATTTGCCGTGTCATTTTCCATACAAATCAG

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000544368_chr12_69986756_+_1221nt
CCCTCATGTGTTCTCAGGTTCTTCTTATTTTTATTCATCTCTAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGG
TAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACT
TACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTTGTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAG
AGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCCCGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAAC
ATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAGCATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATT
ATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCATGCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTG
GTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGAAGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAAC
TCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTTTTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGAT
CATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCTAGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTC
ATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTTGCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCA
TCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAGCTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGG
GAAACGTGTCCCTGATCACCACCCCTGTTAAGCATTCCCACGTGCTGTCGATCTTTGGACCAGTTTCTAGCAAAGTTGTGTTTGAAAGAT
ACTCTATTAAAGAAGACTGTGGAATCTGTTTATCGGTGCCCATTATATCCTTAAGTTTGGATATTTAGCTGACCTTCGCTTTAACATAGG

>In-frame_CPM_ENST00000338356_chr12_69279572_-_CCT2_ENST00000543146_chr12_69986756_+_1403nt
CCCTCATGTGTTCTCAGGTTCTTCTTATTTTTATTCATCTCTAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGG
TAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACT
TACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTTGTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAG
AGTTCAAATACGTGGCAAATATGCATGGAGATGAGATATTTGGTTCCCGGGTAAGAGTTGACTCTACAGCAAAGGTTGCAGAAATAGAAC
ATGCGGAAAAGGAAAAAATGAAGGAGAAAGTTGAACGTATTCTTAAGCATGGAATAAATTGCTTTATTAACAGGCAATTAATTTATAATT
ATCCTGAACAGCTCTTTGGTGCTGCTGGTGTCATGGCTATTGAGCATGCAGATTTTGCAGGTGTGGAACGCCTAGCTCTTGTCACAGGTG
GTGAAATTGCCTCTACCTTTGATCACCCAGAACTGGTGAAGCTTGGAAGTTGCAAACTTATCGAGGAAGTCATGATTGGAGAAGACAAAC
TCATTCACTTTTCTGGGGTTGCCCTTGGTGAGGCTTGTACCATTGTTTTGCGTGGTGCCACTCAACAAATTTTAGATGAAGCAGAAAGAT
CATTGCATGATGCTCTTTGTGTTCTTGCGCAAACTGTAAAGGACTCTAGAACAGTTTATGGAGGAGGCTGTTCTGAGATGTTGATGGCTC
ATGCTGTGACACAGCTTGCCAATAGAACACCAGGCAAAGAAGCTGTTGCAATGGAGTCTTATGCTAAAGCACTGAGAATGTTGCCAACCA
TCATAGCTGACAATGCAGGCTATGACAGTGCAGACCTGGTGGCACAGCTCAGGGCTGCTCACAGTGAAGGCAATACCACTGCTGGATTGG
ATATGAGGGAAGGCACCATTGGAGATATGGCTATCCTGGGTATAACAGAAAGTTTTCAAGTGAAGCGACAGGTTCTTCTGAGTGCAGCTG
AAGCAGCAGAGGTGATTCTGCGTGTGGACAACATCATCAAAGCGGCACCCAGGAAACGTGTCCCTGATCACCACCCCTGTTAAGCATTCC
CACGTGCTGTCGATCTTTGGACCAGTTTCTAGCAAAGTTGTGTTTGAAAGATACTCTATTAAAGAAGACTGTGGAATCTGTTTATCGGTG
CCCATTATATCCTTAAGTTTGGATATTTAGCTGACCTTCGCTTTAACATAGGTCTAATTTATTTGCCGTGTCATTTTCCATACAAATCAG


Top

FusionGenePPI for CPM_CCT2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CPMELAVL1, CAPZA2, DBN1, FLNA, GAK, MYH9, PPP1CC, RAB7A, PDLIM7, ATP6AP2, SYNPO, MAPRE1, GOLT1B, LIMA1, ANLN, MYO19, ZSCAN12, ULBP1, FTH1, TBC1D22B, GTPBP3CCT2ACTB, PPP4C, CTTNBP2, MOB4, PPP2CA, STK24, STRN, STRN3, PPP2CB, PPP2R2C, IGBP1, TCP1, CCNE1, MEPCE, CDK7, RFWD2, ATG16L1, MLST8, MYC, PPP2R2A, PPP2R2B, PPP2R2D, PPP2R4, HDAC5, PSMA3, FBXW8, PCK1, VHL, RAD21, VAV2, FCHSD2, SIRT7, TCF3, ISG15, CUL3, CDK2, CUL1, COPS5, LRRK1, GRB2, SHC1, PACRG, PARK2, GPR37, CCT4, CCT5, CCT3, CCT8, CCT6A, CCT7, CCT6B, SF3B3, PRKCDBP, SSR1, NSFL1C, TRIM28, GSPT2, TXNL1, GSPT1, SMURF1, TUBB, ACTA1, TUBA1B, EEF2, RPS3, HSP90B1, ERLIN2, VCP, PSMD2, XIAP, CASP7, HSP90AB1, PSMC6, HSP90AA1, PPP1CC, FN1, VCAM1, ATF2, PEX14, NOS2, CAMKMT, FAM86B2, METTL18, METTL21B, ITGA4, PAN2, NPM1, HDAC3, FBXW4, FBXO6, PRPF40A, EEF1D, IQGAP1, PSMB8, VRK2, WWOX, CDK5, ILK, UBC, STAU1, CDC20, LGALS3BP, NEDD1, TP53, TUBG1, HUWE1, FUS, SSSCA1, NXF1, CUL7, OBSL1, CCDC8, BUB1B, IKBKE, IRAK1, JAK3, MAPK8, TSSK6, TYK2, WDR76, ESR1, POC1A, FYCO1, LFNG, ENDOV, C11orf54, WDR83, BUB3, DCAF5, PEX7, MAPK10, TUBB2A, TUBB2B, ACTR1B, SEC31B, TUBAL3, ACTL6A, TTLL3, TUBA3E, WRAP73, ATP6V1B1, CDK15, RPS6KB2, DCAF7, AMBRA1, CYB5B, DNAJA1, DNAJA4, GTF2I, HSPA4, HSPH1, PSMC2, HSPE1, KPNA4, NTRK1, KRAS, BTRC, B9D1, MKS1, CETN2, POC1B, AHSA1, DDB2, HDAC1, PDK3, NSMAF, NIPSNAP1, PRPF4, ACTR2, PLK4, WRAP53, RFWD3, KIF21A, TUBA1C, ARMC6, GAN, CRY2, ALKBH3, MCM2, SNW1, CDC5L, U2AF2, TTC27, NLE1, CDC73, WWP2, FLCN, PPM1J, DNAI2, DCAF11, KLHL33, HCFC2, KLHDC8A, P4HA2, RAP2C, WDR86, WDR77, TXNDC9, THOC3, KDM4B, TBL1Y, DCAF10, DCAF8, KLHDC2, HDAC11, TUBG2, WDR34, WDTC1, GNB2, PDDC1, TSSC1, GANAB, TTLL9, ACTBL2, ODF1, WDR5B, KBTBD4, CDK10, CDK11A, ACTR3B, ACTR3, GNB5, STRADB, SMOX, ANGPTL7, MAPK15, PLB1, LCMT2, PNPLA5, THBS3, DCAF4, WDR37, TRMT12, TUBA3C, LRRC10, CELA1, KLHL34, PNPLA1, CYLD, WDR92, DLD, DLST, DNM1L, HSD17B10, PDHA1, SDHA, SOD1, BRCA1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CPM_CCT2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CPM_CCT2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCPMC0014175Endometriosis1CTD_human
HgeneCPMC0037116Silicosis1CTD_human
TgeneCCT2C0029456Osteoporosis1CTD_human