FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8152

FusionGeneSummary for COX10_INPP5K

check button Fusion gene summary
Fusion gene informationFusion gene name: COX10_INPP5K
Fusion gene ID: 8152
HgeneTgene
Gene symbol

COX10

INPP5K

Gene ID

1352

51763

Gene nameCOX10, heme A:farnesyltransferase cytochrome c oxidase assembly factorinositol polyphosphate-5-phosphatase K
Synonyms-MDCCAID|PPS|SKIP
Cytomap

17p12

17p13.3

Type of geneprotein-codingprotein-coding
Descriptionprotoheme IX farnesyltransferase, mitochondrialCOX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferasecytochrome c oxidase assembly homolog 10cytochrome c oxidase assembly proteincytochrome c oxidase subunit Xheme A: farnesyinositol polyphosphate 5-phosphatase Kskeletal muscle and kidney-enriched inositol phosphatase
Modification date2018052320180523
UniProtAcc

Q12887

Q9BT40

Ensembl transtripts involved in fusion geneENST00000261643, ENST00000536205, 
ENST00000537334, ENST00000429152, 
ENST00000421807, ENST00000406424, 
ENST00000320345, ENST00000397335, 
ENST00000542125, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 2 X 2=8
# samples 22
** MAII scorelog2(2/8*10)=1.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: COX10 [Title/Abstract] AND INPP5K [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneINPP5K

GO:0006469

negative regulation of protein kinase activity

12556481

TgeneINPP5K

GO:0010801

negative regulation of peptidyl-threonine phosphorylation

12556481

TgeneINPP5K

GO:0010829

negative regulation of glucose transmembrane transport

12556481

TgeneINPP5K

GO:0016311

dephosphorylation

21712384

TgeneINPP5K

GO:0032869

cellular response to insulin stimulus

12556481

TgeneINPP5K

GO:0033137

negative regulation of peptidyl-serine phosphorylation

12556481

TgeneINPP5K

GO:0043407

negative regulation of MAP kinase activity

12556481

TgeneINPP5K

GO:0043922

negative regulation by host of viral transcription

18774950

TgeneINPP5K

GO:0045719

negative regulation of glycogen biosynthetic process

12556481

TgeneINPP5K

GO:0045869

negative regulation of single stranded viral RNA replication via double stranded DNA intermediate

18774950

TgeneINPP5K

GO:0046627

negative regulation of insulin receptor signaling pathway

12556481

TgeneINPP5K

GO:0046855

inositol phosphate dephosphorylation

12536145

TgeneINPP5K

GO:0046856

phosphatidylinositol dephosphorylation

12536145|12556481

TgeneINPP5K

GO:0051497

negative regulation of stress fiber assembly

12556481

TgeneINPP5K

GO:0051898

negative regulation of protein kinase B signaling

12556481

TgeneINPP5K

GO:0051926

negative regulation of calcium ion transport

12556481

TgeneINPP5K

GO:0071356

cellular response to tumor necrosis factor

21712384

TgeneINPP5K

GO:0071364

cellular response to epidermal growth factor stimulus

21712384

TgeneINPP5K

GO:0090315

negative regulation of protein targeting to membrane

12556481

TgeneINPP5K

GO:0097178

ruffle assembly

12556481


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-W5-AA31-01ACOX10chr17

14063264

+INPP5Kchr17

1401416

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261643ENST00000421807COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000261643ENST00000406424COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000261643ENST00000320345COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000261643ENST00000397335COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000261643ENST00000542125COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000536205ENST00000421807COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000536205ENST00000406424COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000536205ENST00000320345COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000536205ENST00000397335COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000536205ENST00000542125COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000537334ENST00000421807COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000537334ENST00000406424COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000537334ENST00000320345COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000537334ENST00000397335COX10chr17

14063264

+INPP5Kchr17

1401416

-
In-frameENST00000537334ENST00000542125COX10chr17

14063264

+INPP5Kchr17

1401416

-
intron-3CDSENST00000429152ENST00000421807COX10chr17

14063264

+INPP5Kchr17

1401416

-
intron-3CDSENST00000429152ENST00000406424COX10chr17

14063264

+INPP5Kchr17

1401416

-
intron-3CDSENST00000429152ENST00000320345COX10chr17

14063264

+INPP5Kchr17

1401416

-
intron-3CDSENST00000429152ENST00000397335COX10chr17

14063264

+INPP5Kchr17

1401416

-
intron-3CDSENST00000429152ENST00000542125COX10chr17

14063264

+INPP5Kchr17

1401416

-

Top

FusionProtFeatures for COX10_INPP5K


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
COX10

Q12887

INPP5K

Q9BT40

Converts protoheme IX and farnesyl diphosphate to hemeO. {ECO:0000250}. Inositol 5-phosphatase which acts on inositol 1,4,5-trisphosphate, inositol 1,3,4,5-tetrakisphosphate,phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol3,4,5-trisphosphate. Has 6-fold higher affinity forphosphatidylinositol 4,5-bisphosphate than for inositol 1,4,5-trisphosphate (PubMed:10753883). Negatively regulates assembly ofthe actin cytoskeleton. Controls insulin-dependent glucose uptakeamong inositol 3,4,5-trisphosphate phosphatases; therefore, is thespecific regulator for insulin signaling in skeletal muscle (Bysimilarity). {ECO:0000250|UniProtKB:Q8C5L6,ECO:0000269|PubMed:10753883, ECO:0000269|PubMed:28190456,ECO:0000269|PubMed:28190459}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57174_194231444TransmembraneHelical
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000320345-713321_448182373RegionNote=Required for ruffle localization
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000406424-814321_448182373RegionNote=Required for ruffle localization
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000421807-612321_448258449RegionNote=Required for ruffle localization

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57235_255231444TransmembraneHelical
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57257_277231444TransmembraneHelical
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57280_300231444TransmembraneHelical
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57309_329231444TransmembraneHelical
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57364_384231444TransmembraneHelical
HgeneCOX10chr17:14063264chr17:1401416ENST00000261643+57411_431231444TransmembraneHelical
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000320345-71316_318182373RegionCatalytic
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000406424-81416_318182373RegionCatalytic
TgeneINPP5Kchr17:14063264chr17:1401416ENST00000421807-61216_318258449RegionCatalytic


Top

FusionGeneSequence for COX10_INPP5K


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_422aa
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSG
QAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSL
RGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKV

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_422aa
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSG
QAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSL
RGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKV

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_422aa
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSG
QAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSL
RGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKV

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_422aa
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSG
QAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSL
RGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKV

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_422aa
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSG
QAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSL
RGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKV

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_230aa
MICQEFWLDYPKSNSQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGIS
DHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYID

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_230aa
MICQEFWLDYPKSNSQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGIS
DHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYID

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_230aa
MICQEFWLDYPKSNSQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGIS
DHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYID

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_230aa
MICQEFWLDYPKSNSQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGIS
DHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYID

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_230aa
MICQEFWLDYPKSNSQFFEVPFDSNMNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGIS
DHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYID

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_205aa
MNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLM
PEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_205aa
MNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLM
PEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_205aa
MNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLM
PEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_205aa
MNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLM
PEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_205aa
MNRTKNRPLVRGQISEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLM
PEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_1266nt
ATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAG
GACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTAT
GTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGT
CAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAA
CTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTG
TATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCT
CCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTT
GAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGG
ACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTG
AGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCT
GCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGC
AGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTC
TCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAAC
AGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAG

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_1266nt
ATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAG
GACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTAT
GTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGT
CAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAA
CTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTG
TATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCT
CCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTT
GAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGG
ACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTG
AGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCT
GCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGC
AGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTC
TCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAAC
AGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAG

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_1266nt
ATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAG
GACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTAT
GTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGT
CAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAA
CTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTG
TATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCT
CCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTT
GAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGG
ACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTG
AGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCT
GCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGC
AGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTC
TCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAAC
AGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAG

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_1266nt
ATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAG
GACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTAT
GTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGT
CAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAA
CTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTG
TATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCT
CCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTT
GAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGG
ACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTG
AGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCT
GCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGC
AGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTC
TCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAAC
AGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAG

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_1266nt
ATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAG
GACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTAT
GTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGT
CAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAA
CTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTG
TATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCT
CCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTT
GAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGG
ACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTG
AGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCT
GCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGC
AGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTC
TCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAAC
AGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAG

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_690nt
ATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAG
AACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCC
TGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGC
GACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGG
ACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGG
CTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGAC
ATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTC

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_690nt
ATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAG
AACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCC
TGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGC
GACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGG
ACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGG
CTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGAC
ATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTC

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_690nt
ATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAG
AACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCC
TGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGC
GACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGG
ACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGG
CTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGAC
ATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTC

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_690nt
ATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAG
AACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCC
TGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGC
GACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGG
ACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGG
CTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGAC
ATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTC

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_690nt
ATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAG
AACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCC
TGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGC
GACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGG
ACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGG
CTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGAC
ATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTC

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_615nt
ATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGG
CTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATG
ACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATG
CCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGA
CTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAAC
CAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_615nt
ATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGG
CTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATG
ACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATG
CCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGA
CTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAAC
CAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_615nt
ATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGG
CTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATG
ACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATG
CCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGA
CTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAAC
CAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_615nt
ATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGG
CTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATG
ACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATG
CCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGA
CTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAAC
CAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGG

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_615nt
ATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGG
CTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATG
ACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATG
CCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGA
CTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAAC
CAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_2595nt
GGAAGATGGCGGCGCCCAGCGTCCCGTGAGGAGAGAGGACACAGGGATCCCGGGGAGCGGCCCCAGACTCGTAAATTATGGCCGCATCTC
CGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAGGACTCCCCTCACA
AGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTATGTCACACAGCTGA
ACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGTCAAGCCAAAGCAG
AAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAACTAGAGCCAGACT
CAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTGTATGATTTGCCAG
GAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTG
ACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTG
ACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCC
TGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCA
GCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCG
TCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACT
GGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACA
ACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTG
TGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGA
TGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGA
AGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAG
CCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCAT
TTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGC
CGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGT
CTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGA
ATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTC
ACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTC
CCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTG
AGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGG
AGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCAC
ATCCAGCACTTGCCTCCGCCATGGTCACTCGGCAGCCCTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCAT
CCTGTGTCCTGGGACTGAGGGTTACTCCAGTTGCTCTGTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTT

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_2557nt
GGAAGATGGCGGCGCCCAGCGTCCCGTGAGGAGAGAGGACACAGGGATCCCGGGGAGCGGCCCCAGACTCGTAAATTATGGCCGCATCTC
CGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAGGACTCCCCTCACA
AGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTATGTCACACAGCTGA
ACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGTCAAGCCAAAGCAG
AAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAACTAGAGCCAGACT
CAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTGTATGATTTGCCAG
GAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTG
ACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTG
ACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCC
TGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCA
GCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCG
TCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACT
GGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACA
ACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTG
TGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGA
TGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGA
AGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAG
CCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCAT
TTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGC
CGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGT
CTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGA
ATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTC
ACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTC
CCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTG
AGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGG
AGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCAC
ATCCAGCACTTGCCTCCGCCATGGTCACTCGGCAGCCCTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCAT
CCTGTGTCCTGGGACTGAGGGTTACTCCAGTTGCTCTGTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTT

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_2409nt
GGAAGATGGCGGCGCCCAGCGTCCCGTGAGGAGAGAGGACACAGGGATCCCGGGGAGCGGCCCCAGACTCGTAAATTATGGCCGCATCTC
CGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAGGACTCCCCTCACA
AGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTATGTCACACAGCTGA
ACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGTCAAGCCAAAGCAG
AAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAACTAGAGCCAGACT
CAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTGTATGATTTGCCAG
GAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTG
ACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTG
ACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCC
TGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCA
GCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCG
TCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACT
GGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACA
ACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTG
TGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGA
TGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGA
AGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAG
CCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCAT
TTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGC
CGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGT
CTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGA
ATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTC
ACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTC
CCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTG
AGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGG
AGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCAC

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_1599nt
GGAAGATGGCGGCGCCCAGCGTCCCGTGAGGAGAGAGGACACAGGGATCCCGGGGAGCGGCCCCAGACTCGTAAATTATGGCCGCATCTC
CGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAGGACTCCCCTCACA
AGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTATGTCACACAGCTGA
ACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGTCAAGCCAAAGCAG
AAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAACTAGAGCCAGACT
CAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTGTATGATTTGCCAG
GAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTG
ACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTG
ACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCC
TGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCA
GCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCG
TCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACT
GGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACA
ACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTG
TGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGA
TGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGA
AGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAG

>In-frame_COX10_ENST00000261643_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_1536nt
GGAAGATGGCGGCGCCCAGCGTCCCGTGAGGAGAGAGGACACAGGGATCCCGGGGAGCGGCCCCAGACTCGTAAATTATGGCCGCATCTC
CGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATACAGGACTCCCCTCACA
AGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGTATGTCACACAGCTGA
ACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAGGTCAAGCCAAAGCAG
AAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAGAACTAGAGCCAGACT
CAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAGTGTATGATTTGCCAG
GAATTTTGGCTCGACTATCCAAAATCAAACTCACAGCTCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTG
ACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGGCCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTG
ACTCAAACATGAATAGGACAAAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCC
TGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCA
GCCACATGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCG
TCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACT
GGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACA
ACCTGAACCAGGTTTACATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTG
TGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGA
TGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGA
AGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAG

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_2395nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGT
ATGTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAG
GTCAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAG
AACTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAG
TGTATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACA
AAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAG
CCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATC
AGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTG
TGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTG
GGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATC
GACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCC
TTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGG
AGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTC
CACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTT
GTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTC
TTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGT
CTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGT
CCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCC
AGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGC
ATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCAT
CTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCT
TGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTT
TGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCC
ATGGTCACTCGGCAGCCCTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCATCCTGTGTCCTGGGACTGAGG
GTTACTCCAGTTGCTCTGTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTTCCAGCAGGCCATGGCTGGCT

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_2357nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGT
ATGTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAG
GTCAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAG
AACTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAG
TGTATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACA
AAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAG
CCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATC
AGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTG
TGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTG
GGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATC
GACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCC
TTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGG
AGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTC
CACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTT
GTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTC
TTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGT
CTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGT
CCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCC
AGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGC
ATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCAT
CTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCT
TGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTT
TGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCC
ATGGTCACTCGGCAGCCCTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCATCCTGTGTCCTGGGACTGAGG
GTTACTCCAGTTGCTCTGTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTTCCAGCAGGCCATGGCTGGCT

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_2209nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGT
ATGTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAG
GTCAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAG
AACTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAG
TGTATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACA
AAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAG
CCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATC
AGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTG
TGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTG
GGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATC
GACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCC
TTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGG
AGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTC
CACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTT
GTTGCTGAGATGTGAGTGAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTC
TTCTAGTCTTGCCCAAGTAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGT
CTGGGAGGGGAGATGCTCACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGT
CCCCGTGAGGAGTGAGCAGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCC
AGGCTCTTACGCCATGGTTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGC
ATGGAAGTTCCAGATCCTGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCAT
CTGAGGAAGGGGTGACAAGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCT
TGTCAGGAGCCATTGACGACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTT
TGGAGGATCTGGCCCTGGGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCC

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_1399nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGT
ATGTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAG
GTCAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAG
AACTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAG
TGTATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACA
AAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAG
CCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATC
AGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTG
TGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTG
GGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATC
GACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCC
TTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGG
AGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTC
CACATACTCCTCCCAGAGTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTT

>In-frame_COX10_ENST00000536205_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_1336nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGT
ATGTCACACAGCTGAACAGAAGCCACAACCAGCAAGTAAGACCCAAGCCAGAACCAGTAGCATCTCCTTTCCTTGAAAAAACATCTTCAG
GTCAAGCCAAAGCAGAAATATATGAGATGAGACCTCTCTCACCGCCCAGCCTATCTTTGTCCAGAAAGCCAAATGAAAAGGAATTGATAG
AACTAGAGCCAGACTCAGTAATTGAAGACTCAATAGATGTAGGGAAAGAGACAAAAGAGGAAAAGCGGTGGAAAGAGATGAAGCTGCAAG
TGTATGATTTGCCAGGAATTTTGGCTCGACTATCCAAAATCAAACTCACAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACA
AAGAACAGACCGCTGGTTCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAG
CCCTGTGCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATC
AGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTG
TGGACCGTGGAAAATGACATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTG
GGGCTGCGGGACGTTAATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATC
GACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCC
TTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGG
AGGCCAGAGCTGGCAGCCAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTC

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000421807_chr17_1401416_-_2198nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGC
TCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGG
CCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGT
TCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGA
CACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGT
CTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGA
CATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAA
TGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCC
TACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGG
CTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGC
CAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGA
GTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGT
GAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAG
TAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCT
CACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGC
AGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGG
TTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCC
TGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACA
AGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGAC
GACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTG
GGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCCATGGTCACTCGGCAGCC
CTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCATCCTGTGTCCTGGGACTGAGGGTTACTCCAGTTGCTCT
GTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTTCCAGCAGGCCATGGCTGGCTGTTTTGTGACTGTTACA

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000406424_chr17_1401416_-_2160nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGC
TCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGG
CCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGT
TCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGA
CACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGT
CTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGA
CATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAA
TGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCC
TACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGG
CTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGC
CAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGA
GTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGT
GAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAG
TAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCT
CACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGC
AGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGG
TTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCC
TGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACA
AGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGAC
GACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTG
GGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCCATGGTCACTCGGCAGCC
CTTTTCCCAGGAGAAGACACCTCTGGGAGCCTGCTCAGTGCTTGTCCTGCCATCCTGTGTCCTGGGACTGAGGGTTACTCCAGTTGCTCT
GTGTTGCATACTCTCCCCCGCAAGCCTGTGTATGAAGAATTGTCCCCTGGCTTCCAGCAGGCCATGGCTGGCTGTTTTGTGACTGTTACA

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000320345_chr17_1401416_-_2012nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGC
TCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGG
CCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGT
TCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGA
CACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGT
CTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGA
CATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAA
TGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCC
TACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGG
CTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGC
CAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGA
GTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGT
GAAACCAGCTAGTGTGTCAACAGTGAAGACCTGGGGACAGTTCTGCGTCTCATTTCTGGATTCCTACCCCCTCTTCTAGTCTTGCCCAAG
TAGTCCTGCCAGGCACATGCCCCATTTGGCACAGGCCTGCATTCTTGTCGTGCCGTCCTGGGCCTCAGGCTGTCTGGGAGGGGAGATGCT
CACATTTGTACAGGCTACATAGACTGGTGCAAGCAGTGCTGGATTCCAGGAGTCTTGGCATCTCATAGCTTGTCCCCGTGAGGAGTGAGC
AGAGGGTCTGGGATTTCTGCTTTCAGCAAAAGCAGTCTGACTCAGTGGGCAGAATGGAGGGGCCCCTCTAGCCAGGCTCTTACGCCATGG
TTATGAGCAGGTTGATGAGGGTCCTTCGGCCAGCACAACCTTCCTCCCTACTCACGGCATGGAGTCTGACTGCATGGAAGTTCCAGATCC
TGACAGAGAGAACTGGGAAGGATCCAGGTTCGCTTCCGTTGGTAGCTTGAGTCCCATGCCTCCACCCTGCCATCTGAGGAAGGGGTGACA
AGTGGTCAAGGAGCTGTGGCCACAGACTTTTCCAGGGTGGTCCTTGGCAGGTGAGGTGCGTCTGTGCCACCCTTGTCAGGAGCCATTGAC
GACGGGCCCCCCCTGGACCCCCCGGGACCTCAGAGTGGGGGCAGGCAGAAGGGAGAACCAGCTCAAGACATTTTGGAGGATCTGGCCCTG
GGGTTCTTCAGAGAACACCCTCTAGGGGCTTTGGGGACATGGCCTGTCCCCACATCCAGCACTTGCCTCCGCCATGGTCACTCGGCAGCC

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000397335_chr17_1401416_-_1202nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGC
TCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGG
CCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGT
TCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGA
CACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGT
CTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGA
CATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAA
TGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCC
TACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGG
CTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGC
CAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGA
GTGAGCTCTAACCAGGCTCATTTGCTCTCTCCACTACTCATCTCTGGAATTAGCCGCTTAAATACAGGTTTTTGTTGCTGAGATGTGAGT

>In-frame_COX10_ENST00000537334_chr17_14063264_+_INPP5K_ENST00000542125_chr17_1401416_-_1139nt
TTATGGCCGCATCTCCGCACACTCTCTCCTCACGCCTCCTGACAGGTTGCGTAGGAGGCTCTGTCTGGTATCTTGAAAGAAGAACTATAC
AGGACTCCCCTCACAAGTTCTTACATCTTCTCAGGAATGTCAATAAGCAGTGGATTACATTTCAGCACTTTAGCTTCCTCAAACGCATGC
TCTGGTTGTAAGTACCACTGCAGCTGGATTTGCATTGGCTCCGGGCCCTTTTGACTGGCCCTGTTTCCTGCTTACTTCTGTTGGGACAGG
CCTTGCATCCTGTGCTGCCAACTCCATCAATCAGTTTTTTGAGGTGCCATTTGACTCAAACATGAATAGGACAAAGAACAGACCGCTGGT
TCGTGGACAGATCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGTGCTGGCCCCGA
CACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACATGACGTACGGCATCAGCGACCACAAGCCTGT
CTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTCTGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGA
CATGATGGTCAGCTACTCTTCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTAA
TGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTACATCGACATCAGCAATATCCC
TACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGTTCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGG
CTCCTTGAGGGAGGACCCACTGGGTGAAGCACAGCCACAGATCTGAGCCAGGATGGGAGTGAATCCCAGGCGGAGGCCAGAGCTGGCAGC
CAGCTCTGCCTTTCCACTGCCGGGAGTGCTGGGGGCCCAGCCTGGCCCCCTGAAGAGACAGCCAAGTGTCGTCCACATACTCCTCCCAGA


Top

FusionGenePPI for COX10_INPP5K


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
COX10FAM136AINPP5KARL6IP1, NCOR2, RIPK3, HMOX2, TK1, CDKN1A, SMN1, TTR, ANXA7, PFDN1, BDNF, TANK, CPTP, KRT31, MAD2L1BP, FATE1, MOV10, NXF1, PVRL3, AAMP, GPHA2, HSPB1, KATNA1, USP47, RFX1, UBB, C1orf131, PES1, PROSER2, GART, ABHD10, WDYHV1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for COX10_INPP5K


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for COX10_INPP5K


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCOX10C0268237Cytochrome-c Oxidase Deficiency3ORPHANET;UNIPROT