FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8126

FusionGeneSummary for CORO1B_ERBB2

check button Fusion gene summary
Fusion gene informationFusion gene name: CORO1B_ERBB2
Fusion gene ID: 8126
HgeneTgene
Gene symbol

CORO1B

ERBB2

Gene ID

57175

2064

Gene namecoronin 1Berb-b2 receptor tyrosine kinase 2
SynonymsCORONIN-2CD340|HER-2|HER-2/neu|HER2|MLN 19|NEU|NGL|TKR1
Cytomap

11q13.2

17q12

Type of geneprotein-codingprotein-coding
Descriptioncoronin-1Bcoronin, actin binding protein, 1Breceptor tyrosine-protein kinase erbB-2c-erb B2/neu proteinherstatinhuman epidermal growth factor receptor 2metastatic lymph node gene 19 proteinneuro/glioblastoma derived oncogene homologneuroblastoma/glioblastoma derived oncogene homologp185erbB2
Modification date2018052220180527
UniProtAcc

Q9BR76

P04626

Ensembl transtripts involved in fusion geneENST00000393893, ENST00000341356, 
ENST00000539724, ENST00000453768, 
ENST00000545016, 
ENST00000584601, 
ENST00000406381, ENST00000541774, 
ENST00000445658, ENST00000540147, 
ENST00000584450, ENST00000269571, 
ENST00000578199, ENST00000540042, 
ENST00000584888, 
Fusion gene scores* DoF score2 X 2 X 2=817 X 14 X 7=1666
# samples 218
** MAII scorelog2(2/8*10)=1.32192809488736log2(18/1666*10)=-3.21031958903587
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CORO1B [Title/Abstract] AND ERBB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCORO1B

GO:0016477

cell migration

16027158

HgeneCORO1B

GO:0030036

actin cytoskeleton organization

18775315

HgeneCORO1B

GO:0031529

ruffle organization

16027158

HgeneCORO1B

GO:0034316

negative regulation of Arp2/3 complex-mediated actin nucleation

17350576|18775315

HgeneCORO1B

GO:0035767

endothelial cell chemotaxis

23667561

HgeneCORO1B

GO:0042060

wound healing

23667561

HgeneCORO1B

GO:0051017

actin filament bundle assembly

17456547

HgeneCORO1B

GO:0090135

actin filament branching

18775315

HgeneCORO1B

GO:1902463

protein localization to cell leading edge

17350576

HgeneCORO1B

GO:2000394

positive regulation of lamellipodium morphogenesis

17350576

TgeneERBB2

GO:0007165

signal transduction

10572067

TgeneERBB2

GO:0007166

cell surface receptor signaling pathway

9685399

TgeneERBB2

GO:0007169

transmembrane receptor protein tyrosine kinase signaling pathway

7514177

TgeneERBB2

GO:0014065

phosphatidylinositol 3-kinase signaling

7556068

TgeneERBB2

GO:0032886

regulation of microtubule-based process

20937854

TgeneERBB2

GO:0042060

wound healing

12646923

TgeneERBB2

GO:0043406

positive regulation of MAP kinase activity

10572067

TgeneERBB2

GO:0045785

positive regulation of cell adhesion

7556068

TgeneERBB2

GO:0045945

positive regulation of transcription by RNA polymerase III

19372587

TgeneERBB2

GO:0046777

protein autophosphorylation

7556068

TgeneERBB2

GO:0050679

positive regulation of epithelial cell proliferation

10572067

TgeneERBB2

GO:0071363

cellular response to growth factor stimulus

20010870

TgeneERBB2

GO:0090314

positive regulation of protein targeting to membrane

20010870


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12Q-01ACORO1Bchr11

67207589

-ERBB2chr17

37868181

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393893ENST00000584601CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000406381CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000541774CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000445658CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000540147CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000584450CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000269571CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000578199CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
In-frameENST00000393893ENST00000540042CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
5CDS-intronENST00000393893ENST00000584888CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000584601CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000406381CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000541774CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000445658CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000540147CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000584450CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000269571CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000578199CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
Frame-shitENST00000341356ENST00000540042CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
5CDS-intronENST00000341356ENST00000584888CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000584601CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000406381CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000541774CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000445658CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000540147CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000584450CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000269571CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000578199CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000539724ENST00000540042CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-intronENST00000539724ENST00000584888CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000584601CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000406381CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000541774CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000445658CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000540147CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000584450CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000269571CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000578199CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000453768ENST00000540042CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-intronENST00000453768ENST00000584888CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000584601CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000406381CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000541774CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000445658CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000540147CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000584450CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000269571CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000578199CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-3CDSENST00000545016ENST00000540042CORO1Bchr11

67207589

-ERBB2chr17

37868181

+
intron-intronENST00000545016ENST00000584888CORO1Bchr11

67207589

-ERBB2chr17

37868181

+

Top

FusionProtFeatures for CORO1B_ERBB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CORO1B

Q9BR76

ERBB2

P04626

Regulates leading edge dynamics and cell motility infibroblasts. May be involved in cytokinesis and signaltransduction (By similarity). {ECO:0000250,ECO:0000269|PubMed:16027158}. Protein tyrosine kinase that is part of several cellsurface receptor complexes, but that apparently needs a coreceptorfor ligand binding. Essential component of a neuregulin-receptorcomplex, although neuregulins do not interact with it alone. GP30is a potential ligand for this receptor. Regulates outgrowth andstabilization of peripheral microtubules (MTs). Upon ERBB2activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits thephosphorylation and thus the inhibition of GSK3B at cell membrane.This prevents the phosphorylation of APC and CLASP2, allowing itsassociation with the cell membrane. In turn, membrane-bound APCallows the localization of MACF1 to the cell membrane, which isrequired for microtubule capture and stabilization. {ECO:0000305}. In the nucleus is involved in transcriptionalregulation. Associates with the 5'-TCAAATTC-3' sequence in thePTGS2/COX-2 promoter and activates its transcription. Implicatedin transcriptional activation of CDKN1A; the function involvesSTAT3 and SRC. Involved in the transcription of rRNA genes by RNAPol I and enhances protein synthesis and cell growth.{ECO:0000269|PubMed:10358079, ECO:0000269|PubMed:15380516,ECO:0000269|PubMed:21555369}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-811123_166335490RepeatNote=WD 3
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-811167_210335490RepeatNote=WD 4
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-81118_72335490RepeatNote=WD 1
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-811211_256335490RepeatNote=WD 5
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-811257_296335490RepeatNote=WD 6
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-81173_122335490RepeatNote=WD 2
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-912123_166335490RepeatNote=WD 3
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-912167_210335490RepeatNote=WD 4
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-91218_72335490RepeatNote=WD 1
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-912211_256335490RepeatNote=WD 5
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-912257_296335490RepeatNote=WD 6
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-91273_122335490RepeatNote=WD 2
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+627720_9873001256DomainProtein kinase
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+627720_9872851241DomainProtein kinase
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+627676_6893001256MotifNote=Nuclear localization signal
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+627676_6892851241MotifNote=Nuclear localization signal
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+627726_7343001256Nucleotide bindingATP
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+627726_7342851241Nucleotide bindingATP
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+627676_12553001256Topological domainCytoplasmic
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+627676_12552851241Topological domainCytoplasmic
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+627653_6753001256TransmembraneHelical
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+627653_6752851241TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000341356-811449_474335490Coiled coilOntology_term=ECO:0000255
HgeneCORO1Bchr11:67207589chr17:37868181ENST00000393893-912449_474335490Coiled coilOntology_term=ECO:0000255
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+62723_6523001256Topological domainExtracellular
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+62723_6522851241Topological domainExtracellular


Top

FusionGeneSequence for CORO1B_ERBB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584601_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000406381_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000541774_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000445658_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540147_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584450_chr17_37868181_+_1091aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000269571_chr17_37868181_+_1291aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL
LRGPLPQRCET_PLLHAHLEVSR_GGRMPALPHQLHPLLCGPG_QGLPRRAESQPSDVHHLCGGWHSAGRGLGGGLWDPHQATAAEDPEV
HDAETAAGNGAGGAADT_RSDAQPGADADPERDGAEEGEGAWIWRFWHSLQGHLDP_WGECENSSGHQSVEGKHIPQSQQRNLRRSIRDG
WCGLPICLPPSGHLPDIHGAAGDTATALWLPLRPCPGKPRTPGLPGPAELVTADCQGDELPGGCAARTQGLGRSERAGQESQPCQNYRLR
AGSAAGH_RDRVPCRWGQGAHQVDGAGVHSPPAVHPPE_CVELWCDCVGADDFWGQTLRWDPSPGDP_PAGKGGAAAPAPHLHH_CLHDH
GQMLDD_L_MSAKIPGVGV_ILPHGQGPPALCGHPE_GLGPSQSLGQHLLPLTAGGR_HGGPGGC_GVSGTPAGLLLSRPCPGRWGHGPP
QAPQLIYQEWRWGPDTRAGAL_RGGPQVSTGTLRRGWLRCI_W_PGNGGSQGAAKPPHT_PQPSTAVQ_GPHSTPAL_D_WLRCPPDLQP
PA_ICEPARCSAPAPFAPRGPSACCPTCWCHSGKAQDSLPREEWGRQRRFCLWGCRGEPRVLDTPGRSCPSAPPSSCLQPSLRQPLLLGP

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000578199_chr17_37868181_+_669aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540042_chr17_37868181_+_669aa
MSFRKVVRQSKFRHVFGQPVKNDQCTEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDW
CPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
LLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARQLPFYGRGILHPRLPPAQPRGDSR
GWNTAV_EVQQALCPSVLWSGHGALARGEGSYQCQTPGVCWLQEDLWEPGISAGEL_WGPSLQHCPAPARAAPSV_DSGRDHRLPIHLSM
AGQPA_PQRLPEPASNPGTNSAQWRLLADPARAGHQLAGAALTEGTGQWTGPHPP_HPPLLRAHGALGPALSEPAPSSAPHCQPARGRVC
GRGPGLPPAVRPRALLGSRAHPVCQLQPVPSGPGVRGGMPSTAGAPQGVCECQALFAVPP_VSAPEWLSDLFWTGG_PVCGLCPL_GPSL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584601_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000406381_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000541774_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000445658_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540147_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584450_chr17_37868181_+_3274nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000269571_chr17_37868181_+_3874nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC
TTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCAT
CTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTA
CACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCT
GAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAA
TGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGC
TGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTG
CCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTA
CCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGG
GCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCT
CCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGG
GATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCAT
GGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCG
CTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGG
GGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCA
CAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACT
GGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGA
CCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCC
CCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGC
CACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGA
GTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCA
GGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000578199_chr17_37868181_+_2008nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540042_chr17_37868181_+_2008nt
ATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCTATGAGGACATTCGC
GTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTGGAGGGGGTGCCTTT
CTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCCTGGACATCGACTGG
TGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACGGGCTGACCTCCCCG
CTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAAACGTGCTGCTCAGT
GCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACCCTGACCTCATCTAC
AATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCCGTCGGGGCACCCTG
GTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCACCACAGGCTTCAGC
CGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACTCGAGCAACGGGGCC
CTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTGAGATCACAGAGGAG
CCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGGGCCTGGAGGTCAGC
AAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGA
GGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGC
AGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCC
AGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATG
GCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCT
GCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTG
CTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGT
GGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCT
TCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCC
TGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTT
CTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584601_chr17_37868181_+_4295nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT
CTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCAT
CAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCC
CAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000406381_chr17_37868181_+_4596nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT
CTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCAT
CAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCC
CAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTA
GGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAG
CGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCA
ATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACC
CAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGTCCATTTGCAAATATATTTTGGAAAA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000541774_chr17_37868181_+_4596nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT
CTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCAT
CAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCC
CAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTA
GGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAG
CGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCA
ATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACC
CAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGTCCATTTGCAAATATATTTTGGAAAA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000445658_chr17_37868181_+_4013nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540147_chr17_37868181_+_4596nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT
CTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCAT
CAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCC
CAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTA
GGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAG
CGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCA
ATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACC
CAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGTCCATTTGCAAATATATTTTGGAAAA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000584450_chr17_37868181_+_3725nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGG
GCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTT
TTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCC
CAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000269571_chr17_37868181_+_4596nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCT
CTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAG
AAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCG
CAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATC
CCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAA
GCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTT
ATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCC
AAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAA
ATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCG
CTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCC
AAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGAT
GTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCC
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAG
GACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGG
GGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCC
CCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGC
CTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCC
CTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCC
CGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCC
GTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTC
TATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGT
CTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCAT
CAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCC
CAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTA
GGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAG
CGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCA
ATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACC
CAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGTCCATTTGCAAATATATTTTGGAAAA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000578199_chr17_37868181_+_2285nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCT
TTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAA

>In-frame_CORO1B_ENST00000393893_chr11_67207589_-_ERBB2_ENST00000540042_chr17_37868181_+_2281nt
ATTATGAGGAGCAAGAACGCGAAGGGGCCTCGGGTCCGCTAGGCCGGGATCCGGAGCCGCCCGAAGCCGGTGCCGCAGCCCCCTGCGCCC
CCGGTGCCCCCGACATGTCCTTCCGCAAAGTGGTCCGGCAGAGCAAATTCCGGCATGTGTTCGGGCAGCCGGTCAAGAACGACCAGTGCT
ATGAGGACATTCGCGTGTCCCGTGTTACCTGGGACAGCACCTTCTGCGCCGTCAACCCCAAGTTCCTGGCGGTGATTGTGGAGGCCAGTG
GAGGGGGTGCCTTTCTGGTGCTCCCCCTAAGCAAGACGGGCCGCATTGACAAGGCCTACCCGACGGTGTGTGGGCACACGGGACCTGTCC
TGGACATCGACTGGTGTCCTCACAACGACGAAGTCATAGCCAGCGGCTCGGAGGACTGCACGGTCATGGTGTGGCAGATCCCAGAGAACG
GGCTGACCTCCCCGCTGACAGAGCCGGTGGTGGTACTGGAGGGGCACACCAAGCGAGTGGGCATCATCGCCTGGCACCCCACGGCCCGAA
ACGTGCTGCTCAGTGCAGGCTGCGACAACGTGGTACTCATCTGGAATGTGGGCACAGCGGAGGAGCTGTACCGCCTGGACAGCCTGCACC
CTGACCTCATCTACAATGTCAGCTGGAACCACAATGGCAGCCTGTTTTGCTCAGCATGCAAGGACAAGAGCGTGCGCATCATCGACCCCC
GTCGGGGCACCCTGGTGGCAGAGCGGGAGAAGGCTCATGAGGGGGCCCGGCCCATGCGGGCCATCTTCCTGGCAGATGGCAAGGTGTTCA
CCACAGGCTTCAGCCGAATGAGCGAGCGGCAGCTGGCGCTCTGGGACCCAGAAAACCTCGAGGAACCCATGGCCCTGCAGGAACTGGACT
CGAGCAACGGGGCCCTGCTGCCCTTCTACGACCCCGACACCAGTGTGGTCTACGTCTGCGGCAAGGGTGACTCCAGCATCCGGTACTTTG
AGATCACAGAGGAGCCTCCCTACATCCACTTCCTGAACACGTTCACCAGCAAGGAGCCGCAGCGGGGTATGGGCAGCATGCCCAAGCGGG
GCCTGGAGGTCAGCAAGTGCGAGATCGCCCGACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAA
GAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTG
CGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGC
TTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTA
TACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCC
TACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCAT
AACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCA
GAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAAC
TGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGT
TTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTAT
AAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAG
GGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCT
TTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAA


Top

FusionGenePPI for CORO1B_ERBB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CORO1BTERF1, SAFB, NUP107, TPM2, EPPK1, ATP6V1F, CTTN, TELO2, FN1, SOX2, POLR1C, KPNA2, CORO1C, CRMP1, OSBP, OTUD6B, TARS, VPS26A, ZRANB2, ETF1, NUDC, PAPOLA, PARVA, SWAP70, TBC1D17, ZYX, SIRT6, LUZP4, CEP170, IFT57, CORO1A, ACTB, ACTG1, ACTR2, ACTR3, ASPDH, DDB1, MRPL1, NFYB, NFYC, NHP2L1, PHKB, RAD23A, RAD23B, SFTPA2, TXNL1, LSM2, RUVBL2, SPTBN2, TIPRL, CAPZA2, FLNA, MYH9, PPP1CB, IQGAP1, SYNPO, COPS7A, LIMA1, ANLN, MYO5C, MYO19, MYO18A, TRIM15, CDH1, MTMR7, CORO6, G3BP1, TESERBB2SHC1, SH3BGRL, PTPN11, GRB2, MUC1, CTNNB1, ERBB2, CD82, EGF, PAK1, ERBB2IP, PICK1, PIK3R2, DLG4, ERBB4, NRG1, JUP, STAT3, SRC, JAK2, HSP90B1, CD44, GRB7, PLCG1, IL6ST, OSMR, PTK2B, HSP90AA1, ELF3, EGFR, ERBB3, HDAC6, LRIG1, STUB1, HSPA4, IGF1R, CUL5, ESR1, PPP1R13B, H2AFY, PIK3R1, PIN1, PTK6, ACTB, POLR1B, KPNB1, XPO1, CLTC, AP2B1, EEA1, APBB1, SH2B2, IRS4, SH2D1B, SOCS1, NCK2, DAB1, GRAP2, APBB3, ABL1, FGR, CHN1, FER, PLCG2, RASA1, JAK1, IRS1, STAT1, MATK, TEC, TXK, ABL2, SYK, CRK, CRKL, BLK, BMX, VAV2, SH3BP2, SHC2, ITK, SLA, MAPK8IP2, RIN1, BCAR3, TENC1, TNS3, DOK6, SH2D5, SUPT6H, ANKS1B, CLNK, DOK4, BLNK, RIN2, SHC3, PIK3R3, ANKS1A, VAV1, DOK1, SH2D3A, SLA2, SH2D2A, CISH, VAV3, MAPK8IP1, SH2B3, TLN1, SRPK1, CBL, ERRFI1, FRS3, USP2, NXF1, DTWD2, TGFBR2, NAALADL2, LPAR6, VSIG4, PTGER3, CYP17A1, GLCE, IL13RA2, KLK5, LYPD3, NAT2, PRDM14, PSMC3IP, RHOBTB2, THRSP, ANXA6, BAI1, CLCN6, GMPR2, HDLBP, IARS, MTCH1, MUCL1, PHF23, POLD2, PSAP, STK24, TCEAL2, ATP6AP1, TTC9B, UTP18, ATP1A1, EEF1G, TNPO1, PC, SURF4, TFRC, VAPB, PTDSS1, HPSE, ZNF280C, CCDC88A, ZNF622, BTC, PTK2, TGFA, BCAR1, ESRRB, CDC37, EZR, RDX, ITGAV, L1CAM, ITGB1, CHEK2, TOP1, RRM2, CDK4, CDH2, CDH1, PTPN6, PTPRR, PTPRT, PTPRU, PTPRA, PTPRH, MPZL2, SSH1, CD79B, MAS1, HAVCR2, IL4R, PPM1A, PPM1F, ILKAP, DUSP14, DUSP18, DUSP19, STYX, GAB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneERBB2chr11:67207589chr17:37868181ENST00000269571+6271195_11973001256PIK3C2B
TgeneERBB2chr11:67207589chr17:37868181ENST00000541774+6271195_11972851241PIK3C2B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CORO1B_ERBB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneERBB2P04626DB06366PertuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved
TgeneERBB2P04626DB08916AfatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved
TgeneERBB2P04626DB00072TrastuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational
TgeneERBB2P04626DB01259LapatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved|investigational
TgeneERBB2P04626DB05773Trastuzumab emtansineReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational

Top

RelatedDiseases for CORO1B_ERBB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneERBB2C1458155Mammary Neoplasms40CTD_human
TgeneERBB2C0033578Prostatic Neoplasms3CTD_human
TgeneERBB2C0038356Stomach Neoplasms3CTD_human
TgeneERBB2C0001418Adenocarcinoma2CTD_human
TgeneERBB2C0024668Mammary Neoplasms, Experimental2CTD_human
TgeneERBB2C0919267ovarian neoplasm2CTD_human
TgeneERBB2C0007117Basal cell carcinoma1CTD_human
TgeneERBB2C0007134Renal Cell Carcinoma1CTD_human
TgeneERBB2C0009375Colonic Neoplasms1CTD_human
TgeneERBB2C0014859Esophageal Neoplasms1CTD_human
TgeneERBB2C0016978gallbladder neoplasm1CTD_human
TgeneERBB2C0017185Gastrointestinal Neoplasms1CTD_human
TgeneERBB2C0024121Lung Neoplasms1CTD_human
TgeneERBB2C0024232Lymphatic Metastasis1CTD_human
TgeneERBB2C0024667Animal Mammary Neoplasms1CTD_human
TgeneERBB2C0025149Medulloblastoma1CTD_human
TgeneERBB2C0027627Neoplasm Metastasis1CTD_human
TgeneERBB2C0027643Neoplasm Recurrence, Local1CTD_human
TgeneERBB2C0027659Neoplasms, Experimental1CTD_human
TgeneERBB2C0030354Papilloma1CTD_human
TgeneERBB2C0206698Cholangiocarcinoma1CTD_human
TgeneERBB2C0596263Carcinogenesis1CTD_human
TgeneERBB2C2931822Nasopharyngeal carcinoma1CTD_human