FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8031

FusionGeneSummary for COMMD10_AP3S1

check button Fusion gene summary
Fusion gene informationFusion gene name: COMMD10_AP3S1
Fusion gene ID: 8031
HgeneTgene
Gene symbol

COMMD10

AP3S1

Gene ID

51397

1176

Gene nameCOMM domain containing 10adaptor related protein complex 3 subunit sigma 1
SynonymsPTD002CLAPS3|Sigma3A
Cytomap

5q23.1

5q22.3-q23.1

Type of geneprotein-codingprotein-coding
DescriptionCOMM domain-containing protein 10AP-3 complex subunit sigma-1adapter-related protein complex 3 subunit sigma-1adaptor related protein complex 3 sigma 1 subunitclathrin adaptor complex AP3, sigma-3A subunitclathrin-associated/assembly/adapter protein, small 3clathrin-associated/assem
Modification date2018051920180519
UniProtAcc

Q9Y6G5

Q92572

Ensembl transtripts involved in fusion geneENST00000274458, ENST00000515539, 
ENST00000503424, 
ENST00000316788, 
ENST00000505423, 
Fusion gene scores* DoF score4 X 2 X 4=322 X 2 X 3=12
# samples 64
** MAII scorelog2(6/32*10)=0.906890595608518
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/12*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: COMMD10 [Title/Abstract] AND AP3S1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-2F-A9KT-01ACOMMD10chr5

115428397

+AP3S1chr5

115230784

+
TCGARVLGGTCGA-DH-A7US-01ACOMMD10chr5

115428397

+AP3S1chr5

115230784

+
TCGARVLGGTCGA-DB-5273-01ACOMMD10chr5

115428397

+AP3S1chr5

115230784

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000274458ENST00000316788COMMD10chr5

115428397

+AP3S1chr5

115230784

+
In-frameENST00000274458ENST00000505423COMMD10chr5

115428397

+AP3S1chr5

115230784

+
In-frameENST00000515539ENST00000316788COMMD10chr5

115428397

+AP3S1chr5

115230784

+
In-frameENST00000515539ENST00000505423COMMD10chr5

115428397

+AP3S1chr5

115230784

+
intron-3CDSENST00000503424ENST00000316788COMMD10chr5

115428397

+AP3S1chr5

115230784

+
intron-3CDSENST00000503424ENST00000505423COMMD10chr5

115428397

+AP3S1chr5

115230784

+

Top

FusionProtFeatures for COMMD10_AP3S1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
COMMD10

Q9Y6G5

AP3S1

Q92572

May modulate activity of cullin-RING E3 ubiquitin ligase(CRL) complexes (PubMed:21778237). May down-regulate activation ofNF-kappa-B (PubMed:15799966). {ECO:0000269|PubMed:15799966,ECO:0000305|PubMed:21778237}. Part of the AP-3 complex, an adaptor-related complexwhich is not clathrin-associated. The complex is associated withthe Golgi region as well as more peripheral structures. Itfacilitates the budding of vesicles from the Golgi membrane andmay be directly involved in trafficking to lysosomes. In concertwith the BLOC-1 complex, AP-3 is required to target cargos intovesicles assembled at cell bodies for delivery into neurites andnerve terminals.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCOMMD10chr5:115428397chr5:115230784ENST00000274458+47133_202133203DomainCOMM


Top

FusionGeneSequence for COMMD10_AP3S1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_236aa
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPA
ALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIV

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_169aa
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_222aa
MKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQD
KAEAFVNTWSSMGQETVEKFRQRILAPCKVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_155aa
MKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQD

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_236aa
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPA
ALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIV

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_169aa
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_222aa
MKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQD
KAEAFVNTWSSMGQETVEKFRQRILAPCKVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_155aa
MKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_708nt
ATGGCGGTCCCCGCGGCGCTGATCCTACGGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTT
CCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCA
TTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCA
GCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACA
GTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGAT
TTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTT
ACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATG

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_507nt
ATGGCGGTCCCCGCGGCGCTGATCCTACGGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTT
CCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCA
TTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCA
GCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACA
GTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_666nt
ATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAG
GCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACA
ATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGAC
AAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTA
TTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAA
ATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCT
GGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATC

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_465nt
ATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAG
GCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACA
ATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGAC
AAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTT
CACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAG

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_708nt
ATGGCGGTCCCCGCGGCGCTGATCCTACGGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTT
CCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCA
TTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCA
GCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACA
GTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGAT
TTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTT
ACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATG

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_507nt
ATGGCGGTCCCCGCGGCGCTGATCCTACGGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTT
CCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCA
TTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCA
GCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACA
GTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_666nt
ATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAG
GCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACA
ATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGAC
AAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTA
TTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAA
ATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCT
GGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATC

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_465nt
ATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAG
GCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACA
ATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGAC
AAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTT
CACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_1361nt
GCGGCCGCCATTGGCTGGGTTCGGCGCAGCTAACAGACGGCGGCAGTGCGAGAAAGCCGAAGATGGCGGTCCCCGCGGCGCTGATCCTAC
GGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAA
AACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACC
TAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTC
ATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGG
CTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGTTCACA
ATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAGCTGG
AAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTA
ACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAAATCCAGGGGGAA
GAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGTCAAGGTACTGTA
TAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCCTATGTGATTTTT
TTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAAGTGTTTCAGATA
TTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCATTCCTTAATTCCTTCTGCTATATGTCACACA
GTTGTTATTTGGAGAACCAAGTATGTATTGCATGAAAACATTATGACTTTTTTCTCTTAGTTTAAATAAACTCCAAGGTAACTGGACTTC
TAAAGCACCTTTCTGTTTGCCTGATATCTACTTTAGCAATAATTTTTTTTACAACCCTCTGACTCAACAAAGTAAATAAAAGTATATTTT

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_1072nt
GCGGCCGCCATTGGCTGGGTTCGGCGCAGCTAACAGACGGCGGCAGTGCGAGAAAGCCGAAGATGGCGGTCCCCGCGGCGCTGATCCTAC
GGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAA
AACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACC
TAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTC
ATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGG
CTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGCTGGCT
TAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATCAGTA
TAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAAATCCAGGGGGAAGAGTCATCTAAGTTTACC
ATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGTCAAGGTACTGTATAGAAGTTGTGTAAAATC
AGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCCTATGTGATTTTTTTTTTTCTTTTCTAAACT
GCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAAGTGTTTCAGATATTTCTCTAATTATGTACA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_1391nt
GACACTCTGGTGGGAAAGGCTCACGCTGCTGCTGGAGGGTCTTTAATAGCCAACATGTGTTAATACCCCTTTTAAATCAGTATCGAATAG
GGGACCGAATTTTTGGTTGGTAGAAGAATCTAGCCTGGCTTTGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGAT
TTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGG
CATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAG
CAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAA
CAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGG
ATTTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTG
TTACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATA
TGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAA
AGGCCACTCCCAGGTAAAATCCAGGGGGAAGAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTT
TTGCTCTTGGATTTAAGTCAAGGTACTGTATAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTA
AAGAAATTGAGTAGTTCCTATGTGATTTTTTTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCT
ACTACAGTGTTTTAAAAAGTGTTTCAGATATTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCAT
TCCTTAATTCCTTCTGCTATATGTCACACAGTTGTTATTTGGAGAACCAAGTATGTATTGCATGAAAACATTATGACTTTTTTCTCTTAG
TTTAAATAAACTCCAAGGTAACTGGACTTCTAAAGCACCTTTCTGTTTGCCTGATATCTACTTTAGCAATAATTTTTTTTACAACCCTCT

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_1102nt
GACACTCTGGTGGGAAAGGCTCACGCTGCTGCTGGAGGGTCTTTAATAGCCAACATGTGTTAATACCCCTTTTAAATCAGTATCGAATAG
GGGACCGAATTTTTGGTTGGTAGAAGAATCTAGCCTGGCTTTGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGAT
TTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGG
CATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAG
CAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAA
CAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGG
ATTTGATTTTCCATGTAGACAAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCC
CAAGAAATATTAACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAA
ATCCAGGGGGAAGAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGT
CAAGGTACTGTATAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCC
TATGTGATTTTTTTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAA
GTGTTTCAGATATTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCATTCCTTAATTCCTTCTGCT

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_1361nt
GCGGCCGCCATTGGCTGGGTTCGGCGCAGCTAACAGACGGCGGCAGTGCGAGAAAGCCGAAGATGGCGGTCCCCGCGGCGCTGATCCTAC
GGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAA
AACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACC
TAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTC
ATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGG
CTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGTTCACA
ATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTGTTACACAAATTGATGCACAAAATAAGCTGG
AAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTA
ACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAAATCCAGGGGGAA
GAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGTCAAGGTACTGTA
TAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCCTATGTGATTTTT
TTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAAGTGTTTCAGATA
TTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCATTCCTTAATTCCTTCTGCTATATGTCACACA
GTTGTTATTTGGAGAACCAAGTATGTATTGCATGAAAACATTATGACTTTTTTCTCTTAGTTTAAATAAACTCCAAGGTAACTGGACTTC
TAAAGCACCTTTCTGTTTGCCTGATATCTACTTTAGCAATAATTTTTTTTACAACCCTCTGACTCAACAAAGTAAATAAAAGTATATTTT

>In-frame_COMMD10_ENST00000274458_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_1072nt
GCGGCCGCCATTGGCTGGGTTCGGCGCAGCTAACAGACGGCGGCAGTGCGAGAAAGCCGAAGATGGCGGTCCCCGCGGCGCTGATCCTAC
GGGAGAGCCCCAGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGATTTCCACGGTTGCTCACTCGGATTCTTCAAA
AACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGGCATTTTCTCTAGAGAAACAAGATCTTCACC
TAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAGCAGCTTTGCAGCAGCAATTAGAGAACATTC
ATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAACAGTTGAAAAGTTCCGGCAGAGAATTCTGG
CTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGGATTTGATTTTCCATGTAGACAAGGCTGGCT
TAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATCAGTA
TAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAAATCCAGGGGGAAGAGTCATCTAAGTTTACC
ATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGTCAAGGTACTGTATAGAAGTTGTGTAAAATC
AGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCCTATGTGATTTTTTTTTTTCTTTTCTAAACT
GCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAAGTGTTTCAGATATTTCTCTAATTATGTACA

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000316788_chr5_115230784_+_1391nt
GACACTCTGGTGGGAAAGGCTCACGCTGCTGCTGGAGGGTCTTTAATAGCCAACATGTGTTAATACCCCTTTTAAATCAGTATCGAATAG
GGGACCGAATTTTTGGTTGGTAGAAGAATCTAGCCTGGCTTTGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGAT
TTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGG
CATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAG
CAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAA
CAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGG
ATTTGATTTTCCATGTAGACAAGGTTCACAATATTCTTGCAGAAATGGTGATGGGGGGAATGGTATTGGAGACAAATATGAATGAGATTG
TTACACAAATTGATGCACAAAATAAGCTGGAAAAATCTGAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATA
TGAATCTTCCTGAGATCCCAAGAAATATTAACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAA
AGGCCACTCCCAGGTAAAATCCAGGGGGAAGAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTT
TTGCTCTTGGATTTAAGTCAAGGTACTGTATAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTA
AAGAAATTGAGTAGTTCCTATGTGATTTTTTTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCT
ACTACAGTGTTTTAAAAAGTGTTTCAGATATTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCAT
TCCTTAATTCCTTCTGCTATATGTCACACAGTTGTTATTTGGAGAACCAAGTATGTATTGCATGAAAACATTATGACTTTTTTCTCTTAG
TTTAAATAAACTCCAAGGTAACTGGACTTCTAAAGCACCTTTCTGTTTGCCTGATATCTACTTTAGCAATAATTTTTTTTACAACCCTCT

>In-frame_COMMD10_ENST00000515539_chr5_115428397_+_AP3S1_ENST00000505423_chr5_115230784_+_1102nt
GACACTCTGGTGGGAAAGGCTCACGCTGCTGCTGGAGGGTCTTTAATAGCCAACATGTGTTAATACCCCTTTTAAATCAGTATCGAATAG
GGGACCGAATTTTTGGTTGGTAGAAGAATCTAGCCTGGCTTTGCATGAAGAAAGCAGTGTCACTGATAAATGCAATAGATACAGGAAGAT
TTCCACGGTTGCTCACTCGGATTCTTCAAAAACTTCACCTGAAGGCTGAGAGCAGTTTCAGTGAAGAAGAGGAAGAAAAACTTCAAGCGG
CATTTTCTCTAGAGAAACAAGATCTTCACCTAGTTCTTGAAACAATATCATTTATTTTAGAACAGGCAGTGTATCACAATGTGAAGCCAG
CAGCTTTGCAGCAGCAATTAGAGAACATTCATCTTAGACAAGACAAAGCTGAAGCATTTGTCAATACGTGGTCTTCTATGGGTCAAGAAA
CAGTTGAAAAGTTCCGGCAGAGAATTCTGGCTCCCTGTAAGGTATTTGTGGAAACATTAGACAAATGTTTTGAAAATGTCTGTGAGCTGG
ATTTGATTTTCCATGTAGACAAGGCTGGCTTAGCAGGAGCTCCAGCCCGTGCTGTATCAGCTGTAAAGAATATGAATCTTCCTGAGATCC
CAAGAAATATTAACATTGGTGACATCAGTATAAAAGTGCCAAACCTGCCCTCTTTTAAATAAAAATGTAAAAAGGCCACTCCCAGGTAAA
ATCCAGGGGGAAGAGTCATCTAAGTTTACCATGCAGTTGTTTACCAAAAATAGAGGAGGAGAGTCTTAACTTTTGCTCTTGGATTTAAGT
CAAGGTACTGTATAGAAGTTGTGTAAAATCAGTATGAAAGTTCAATGTTGCTGTTCTTGCTCAGTGATTTTAAAGAAATTGAGTAGTTCC
TATGTGATTTTTTTTTTTCTTTTCTAAACTGCATTCCTGTGCCCACCTACGGCATGCCTCTATGTATTGGCTACTACAGTGTTTTAAAAA
GTGTTTCAGATATTTCTCTAATTATGTACAACCTAAAATGTTGGTGTTTTGTATGGATCACAAGTGCAGCATTCCTTAATTCCTTCTGCT


Top

FusionGenePPI for COMMD10_AP3S1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
COMMD10COMMD1, RELA, RELB, NFKB1, COMMD7, COMMD8, CCDC22, COMMD6, COMMD3, COMMD4, CCDC93, COMMD2, COMMD5, FAM45A, VPS29, C16orf62, TRIM13, COMMD9, FKBP15, TCTEX1D2, DSCR3, TRAF7, C11orf73, TP53RK, TPRKB, ACOT9AP3S1IRS1, ELAVL1, AP3B1, ECT2, AP3D1, AP3M1, FLNC, KRT7, RABL6, SMC4, SSSCA1, EGFR, STAU1, RUFY1, KLK11, SRPRB, KLK5, AGO3, DTNBP1, RNF13, VSIG4, EPB41L3, CDC73, XPO1, CD14, EMC2, ZWINT, KIAA1107, PCDHB15, DUSP1, DUSP19, DUSP2, DUSP23, DUSP4, DUSP5, DUSP6, AP3M2, AP3B2, RNF167, TMEM63A, DHRS2, FBXO11, ZYG11B, MUC20, AGK, PMEL, TPCN2, IRGC, IGSF6, VSIG1, ICAM1, SPG7, FNDC3A, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for COMMD10_AP3S1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for COMMD10_AP3S1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAP3S1C0023893Liver Cirrhosis, Experimental1CTD_human