FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7954

FusionGeneSummary for COL4A1_ZNF675

check button Fusion gene summary
Fusion gene informationFusion gene name: COL4A1_ZNF675
Fusion gene ID: 7954
HgeneTgene
Gene symbol

COL4A1

ZNF675

Gene ID

1282

171392

Gene namecollagen type IV alpha 1 chainzinc finger protein 675
SynonymsBSVD|RATORTBZF|TIZ
Cytomap

13q34

19p12

Type of geneprotein-codingprotein-coding
Descriptioncollagen alpha-1(IV) chainCOL4A1 NC1 domainarrestencollagen IV, alpha-1 polypeptidecollagen of basement membrane, alpha-1 chainzinc finger protein 675TRAF6 inhibitory zinc fingerTRAF6-binding zinc finger proteinTRAF6-inhibitory zinc finger protein
Modification date2018052720180519
UniProtAcc

P02462

Q8TD23

Ensembl transtripts involved in fusion geneENST00000375820, ENST00000543140, 
ENST00000467182, 
ENST00000601935, 
ENST00000600313, ENST00000596211, 
ENST00000359788, ENST00000601010, 
ENST00000599168, 
Fusion gene scores* DoF score7 X 9 X 5=3153 X 2 X 3=18
# samples 93
** MAII scorelog2(9/315*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: COL4A1 [Title/Abstract] AND ZNF675 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneZNF675

GO:0000122

negative regulation of transcription by RNA polymerase II

11751921

TgeneZNF675

GO:0007249

I-kappaB kinase/NF-kappaB signaling

11751921

TgeneZNF675

GO:0010804

negative regulation of tumor necrosis factor-mediated signaling pathway

11751921

TgeneZNF675

GO:0019221

cytokine-mediated signaling pathway

11751921

TgeneZNF675

GO:0032088

negative regulation of NF-kappaB transcription factor activity

11751921

TgeneZNF675

GO:0043508

negative regulation of JUN kinase activity

11751921

TgeneZNF675

GO:0045671

negative regulation of osteoclast differentiation

11751921|11851921

TgeneZNF675

GO:0046329

negative regulation of JNK cascade

11751921

TgeneZNF675

GO:2000660

negative regulation of interleukin-1-mediated signaling pathway

11751921

TgeneZNF675

GO:2000678

negative regulation of transcription regulatory region DNA binding

11751921


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPAADTCGA-2J-AABP-01ACOL4A1chr13

110959291

-ZNF675chr19

23845960

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375820ENST00000601935COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000375820ENST00000600313COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000375820ENST00000596211COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000375820ENST00000359788COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000375820ENST00000601010COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000375820ENST00000599168COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000601935COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000600313COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000596211COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000359788COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000601010COL4A1chr13

110959291

-ZNF675chr19

23845960

-
In-frameENST00000543140ENST00000599168COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000601935COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000600313COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000596211COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000359788COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000601010COL4A1chr13

110959291

-ZNF675chr19

23845960

-
intron-3CDSENST00000467182ENST00000599168COL4A1chr13

110959291

-ZNF675chr19

23845960

-

Top

FusionProtFeatures for COL4A1_ZNF675


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
COL4A1

P02462

ZNF675

Q8TD23

May be involved in transcriptional regulation. May playa role during osteoclast differentiation by modulating TRAF6signaling activity.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-044_751569DomainKRAB
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04144_1661569Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04172_1941569Zinc fingerC2H2-type 2%3B degenerate
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04200_2221569Zinc fingerC2H2-type 3%3B degenerate
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04228_2501569Zinc fingerC2H2-type 4%3B degenerate
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04256_2781569Zinc fingerC2H2-type 5
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04284_3061569Zinc fingerC2H2-type 6
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04312_3341569Zinc fingerC2H2-type 7
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04340_3621569Zinc fingerC2H2-type 8
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04368_3901569Zinc fingerC2H2-type 9
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04396_4181569Zinc fingerC2H2-type 10
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04424_4461569Zinc fingerC2H2-type 11
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04452_4741569Zinc fingerC2H2-type 12
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04480_5021569Zinc fingerC2H2-type 13
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04508_5301569Zinc fingerC2H2-type 14
TgeneZNF675chr13:110959291chr19:23845960ENST00000359788-04536_5581569Zinc fingerC2H2-type 15

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCOL4A1chr13:110959291chr19:23845960ENST00000375820-1521445_1669281670DomainCollagen IV NC1
HgeneCOL4A1chr13:110959291chr19:23845960ENST00000375820-152173_1440281670RegionNote=Triple-helical region


Top

FusionGeneSequence for COL4A1_ZNF675


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_145aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_146aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_107aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_596aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL
TVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVDECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVF
NKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQFSNL
TEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLTTHKKIHTGEQPYICEECGKAFTQSSTLTTHKRI
HTGEKPYKCEECGKAFNRSSKLTEHKNIHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTGEKP
YKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFKHSSSLTTHKRIHTGEKPYKCEEC

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_129aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_105aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_145aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_146aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_107aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_596aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL
TVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVDECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVF
NKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQFSNL
TEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLTTHKKIHTGEQPYICEECGKAFTQSSTLTTHKRI
HTGEKPYKCEECGKAFNRSSKLTEHKNIHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTGEKP
YKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFKHSSSLTTHKRIHTGEKPYKCEEC

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_129aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_105aa
MGPRLSVWLLLLPAALLLHEEHSRAAAKGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_435nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGATCTGTGGGACAGACCCAGCAGGTGGTGCCCCATGTAAGAAGCAATGAAATG

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_438nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTCTCCCTCTGATGCCGAGCCGAAGCTGGACTGTACTGCTGCCATCTCTGCTC

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_321nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_1788nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGTAATGTGTTCTCATTTTGCCCAAGAGTTTTGGCCAGAGCAGAACATAAAAGAT
TCTTTTGAAAAAGTGACACTGAGAAGATATGAAAAATGTGGAAATGATAATTTTCAGTTAAAAGGCTGTAAAAGTGTGGATGAATGTAAG
TTGCACAAGGGAGGTTATAATGGACTTAACCAATGTTTACCAACTATGCAGAGCAAAATGTTTCAATGTGATAAATATGTGAAAGTCTTT
AATAAATTTTCACATTCAGATAGACATAAGATAAAACATATGGAAAATAAACCTTTCAAATGTAAAGAATGTGGCAGATCATTTTGCATG
CTTTCACACCTAACTCGACATGAAAGAAATTATACCAAGGTGAATTTCTGCAAATGTGAAGAATGTGAAAAAGCTGTTAACCAATCTTCA
AAGCTTACTAAACATAAAAGAATTTATACTTGTGAGAAACTCTACAAATGTCAAGAATGTGACAGAACTTTTAACCAATTCTCAAACCTT
ACTGAATATAAAAAAGATTATGCTCGAGAGAAACCATACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTCCTCACACCTTACTACA
CATAAGATAATTCATACAGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTTCTCAAATCTTACTACACATAAA
AAAATTCATACTGGAGAGCAACCCTACATATGTGAAGAATGTGGCAAGGCTTTTACCCAATCCTCAACCCTTACTACACATAAGAGAATT
CATACTGGAGAAAAACCCTACAAATGTGAAGAATGTGGAAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATAAAAACATTCATACT
GGAGAGCAACCCTACAAATGTGAGGAATGCGGCAAAGCTTTTAACCGATCCTCAAATCTTACGGAACATAGGAAAATTCATACCGAAGAG
AAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTTAAACACTCCTCAGCCCTTACTACACATAAGAGAATTCACACTGGAGAGAAACCC
TACAAATGTGAAGAATGTGGCAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATAAGAAACTTCATACTGGAAAGAAACCCTACAAA
TGTGAAGAATGTGGCAAAGCTTTTATCCAATCCTCAAAACTTACTGAACATAAGAAAATTCATTCTGGAGAGATACCCTACAAGTGTGAA
GAATGTGGCAAAGCTTTTAAACACTCCTCATCCCTTACTACACATAAAAGAATTCATACTGGGGAGAAACCCTACAAATGTGAAGAATGT
GGCAAAGCTTTTAGCCGATCCTCAAAACTTACTGAACATAAGATAATTCATACTGGAGAGAAACCCTATAAATGTGAGAGATGTGACAAA

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_387nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGAGTCTCGCCCTGTCGTCCAGCCTGAAGTTCAGTGGTACAATCTCTGCTTACTG

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_315nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_435nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGATCTGTGGGACAGACCCAGCAGGTGGTGCCCCATGTAAGAAGCAATGAAATG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_438nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTCTCCCTCTGATGCCGAGCCGAAGCTGGACTGTACTGCTGCCATCTCTGCTC

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_321nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_1788nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGTAATGTGTTCTCATTTTGCCCAAGAGTTTTGGCCAGAGCAGAACATAAAAGAT
TCTTTTGAAAAAGTGACACTGAGAAGATATGAAAAATGTGGAAATGATAATTTTCAGTTAAAAGGCTGTAAAAGTGTGGATGAATGTAAG
TTGCACAAGGGAGGTTATAATGGACTTAACCAATGTTTACCAACTATGCAGAGCAAAATGTTTCAATGTGATAAATATGTGAAAGTCTTT
AATAAATTTTCACATTCAGATAGACATAAGATAAAACATATGGAAAATAAACCTTTCAAATGTAAAGAATGTGGCAGATCATTTTGCATG
CTTTCACACCTAACTCGACATGAAAGAAATTATACCAAGGTGAATTTCTGCAAATGTGAAGAATGTGAAAAAGCTGTTAACCAATCTTCA
AAGCTTACTAAACATAAAAGAATTTATACTTGTGAGAAACTCTACAAATGTCAAGAATGTGACAGAACTTTTAACCAATTCTCAAACCTT
ACTGAATATAAAAAAGATTATGCTCGAGAGAAACCATACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTCCTCACACCTTACTACA
CATAAGATAATTCATACAGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTTCTCAAATCTTACTACACATAAA
AAAATTCATACTGGAGAGCAACCCTACATATGTGAAGAATGTGGCAAGGCTTTTACCCAATCCTCAACCCTTACTACACATAAGAGAATT
CATACTGGAGAAAAACCCTACAAATGTGAAGAATGTGGAAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATAAAAACATTCATACT
GGAGAGCAACCCTACAAATGTGAGGAATGCGGCAAAGCTTTTAACCGATCCTCAAATCTTACGGAACATAGGAAAATTCATACCGAAGAG
AAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTTAAACACTCCTCAGCCCTTACTACACATAAGAGAATTCACACTGGAGAGAAACCC
TACAAATGTGAAGAATGTGGCAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATAAGAAACTTCATACTGGAAAGAAACCCTACAAA
TGTGAAGAATGTGGCAAAGCTTTTATCCAATCCTCAAAACTTACTGAACATAAGAAAATTCATTCTGGAGAGATACCCTACAAGTGTGAA
GAATGTGGCAAAGCTTTTAAACACTCCTCATCCCTTACTACACATAAAAGAATTCATACTGGGGAGAAACCCTACAAATGTGAAGAATGT
GGCAAAGCTTTTAGCCGATCCTCAAAACTTACTGAACATAAGATAATTCATACTGGAGAGAAACCCTATAAATGTGAGAGATGTGACAAA

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_387nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG
ACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGAGTCTCGCCCTGTCGTCCAGCCTGAAGTTCAGTGGTACAATCTCTGCTTACTG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_315nt
ATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCGCTGCGAAGGGACTG
TTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTATATAAAAATGTGATT
TTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAGAAAAAGAGCCTTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_1483nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGATCTGTGGGACAGACCCAGC
AGGTGGTGCCCCATGTAAGAAGCAATGAAATGCATCATGATGGAACCCTCAAAAACGAAAGTGAAGTTACTGCACACCCCTTAGGTCCTC
TTTGGATTCCAGCATGATGCATCAAACCTTACCACGGCATGACTAGGGCCCAACCTGCTACCAGAAATAAAGGAAATGACGATGCAGAAC
CCACAACCCTGGATGATGTGGCTTCCTTGGATGACACAGGCCCCAGACATTACCTGGGGAATGCTGAAGAACACAACTCAGGAGGCTGAA
CAAATCTGCTTCAGACACAGATACCATTCAATCCATATAATTTGTTCTTTGCTATGCTTTTTATTCCACATTGCAACTCTTATAGAATAC
TGATTCTTCTTATTCTCTCTTTTTGCCTGCAACCCACACCTGCTATAAACTATTGGGCCCATCTTCTAGATCTGCCTTTCTTACGGCATT
TTACTTGGGAAGGTACCCCCTTCTCAGCCTCTGACAACGTGACCAATTGGCTGGGAGGTATTGACTTACCCCCGGTGGGGTCCCTCAGTA
ATGGCACACATTGGACTCAGGTGCCAAGTAACATTACATATCAATCCTTGATTGGAAAAGAATAATATTGATTATACTCATGTTTGTCTT
ATGTTATTTACTGGTTCTAGGGTGCAAAGCTGGAACACAAACTGTAACCATTGCACCAGTCAAACCTGTCGCTGCTCAGATCTGTATGCT
TCAATCAACAAAACCTGATGCAAAAAAACAGAAAAAGGGGAGATGTGGGAGATTGGTCAGAGTGGTGGAAAAAGGATAGGGAAAGAACGC
AAATTTTCTGAAATGTTGGAAGGTCCTGCAGAGCTCCAGGGGAGAATAGCTGAAGGCAGCTGTTCTATAACCCTGAGGCAGAGAGCAAGC
AGTAGGTACAAGGGAGTGTGGAAGAATTTATCTTAAACAGGCTTATTTACTTATGTTGATCAGGAACTGACCTTTGATCATTTGCGTGTG

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_567nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTCTCCCTCTGATGCCGAGCC
GAAGCTGGACTGTACTGCTGCCATCTCTGCTCACTGCAACCTCCCTGCCTGATTCTCCTGCCTCAGCCTGCCGAGTGCCTGCGATTGCAG

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_605nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGCCAAAAGCAATAGCCGATTT
GGATACCATCAAGACACCTGAAACCTTATCATGAGCCAGATGCCAAGGAAGAGACTCTGGGAGGATCCCAAGGACCCCCTGGTTGCAGCC

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_2335nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGTAATGTGTTCTCATTTTGCCC
AAGAGTTTTGGCCAGAGCAGAACATAAAAGATTCTTTTGAAAAAGTGACACTGAGAAGATATGAAAAATGTGGAAATGATAATTTTCAGT
TAAAAGGCTGTAAAAGTGTGGATGAATGTAAGTTGCACAAGGGAGGTTATAATGGACTTAACCAATGTTTACCAACTATGCAGAGCAAAA
TGTTTCAATGTGATAAATATGTGAAAGTCTTTAATAAATTTTCACATTCAGATAGACATAAGATAAAACATATGGAAAATAAACCTTTCA
AATGTAAAGAATGTGGCAGATCATTTTGCATGCTTTCACACCTAACTCGACATGAAAGAAATTATACCAAGGTGAATTTCTGCAAATGTG
AAGAATGTGAAAAAGCTGTTAACCAATCTTCAAAGCTTACTAAACATAAAAGAATTTATACTTGTGAGAAACTCTACAAATGTCAAGAAT
GTGACAGAACTTTTAACCAATTCTCAAACCTTACTGAATATAAAAAAGATTATGCTCGAGAGAAACCATACAAATGTGAAGAATGTGGCA
AAGCCTTTAACCAGTCCTCACACCTTACTACACATAAGATAATTCATACAGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCT
TTAACCAGTTCTCAAATCTTACTACACATAAAAAAATTCATACTGGAGAGCAACCCTACATATGTGAAGAATGTGGCAAGGCTTTTACCC
AATCCTCAACCCTTACTACACATAAGAGAATTCATACTGGAGAAAAACCCTACAAATGTGAAGAATGTGGAAAAGCTTTTAACCGATCCT
CAAAACTTACTGAACATAAAAACATTCATACTGGAGAGCAACCCTACAAATGTGAGGAATGCGGCAAAGCTTTTAACCGATCCTCAAATC
TTACGGAACATAGGAAAATTCATACCGAAGAGAAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTTAAACACTCCTCAGCCCTTACTA
CACATAAGAGAATTCACACTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATA
AGAAACTTCATACTGGAAAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTATCCAATCCTCAAAACTTACTGAACATAAGAAAA
TTCATTCTGGAGAGATACCCTACAAGTGTGAAGAATGTGGCAAAGCTTTTAAACACTCCTCATCCCTTACTACACATAAAAGAATTCATA
CTGGGGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTAGCCGATCCTCAAAACTTACTGAACATAAGATAATTCATACTGGAG
AGAAACCCTATAAATGTGAGAGATGTGACAAAGCTTTTAACCAATCTGCAAACCTTACTAAACATAAAAAAATACATACTGGAGAGAAAC
TACAGAACTGGAATGTGTGATAATGATTTTGACAACACCTCAAATTTTTCTAAATATAAAGGAAATCATACTGGTGAAAAATTCTAGAAA
TGTAAAGAATGTGTCAAAGACTTTAAATGGTTTTCACACTTCATTGTATGTAAGATAATTCATACTGGAGAAAACTACAAGTGTGAAGAA
TTTGGCAATACTGTTAATTAAGGCTCAAACCTTATTGCACAGGAAAGCGTTTATACTTAAGAAAAATTGTACAAATATAAAGAGTGTAAA
ATAGCCATTAATATCTGTTGACATCTTAATATCAGAATGTTGGTACTTAATAAAAGCATTATAAATGCAATTACTGTCTAAAGACTTTAA

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_717nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGAGTCTCGCCCTGTCGTCCAGC
CTGAAGTTCAGTGGTACAATCTCTGCTTACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCCTGTCTCAGCCTCCTGAGTAGCTGGG
ACTATAGGCACATGCCACCATGCCTGACTAATTTTTGTACTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAAGCTGGTCTTGAACTC

>In-frame_COL4A1_ENST00000375820_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_608nt
GCTTGGAGCCGCCGCACCCGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGG
CAGCCGTCCCTCGCCGCCTCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACG
AGGAGCACAGCCGGGCCGCTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACA
CTGCACAGCGGAATTTATATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGA
TCACCTGTCTGGAGCAAGAAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTAAGTGAGAATGAAAGTGAA
TACAACAGGTGACACTGATGAGAGGTCCAAAGGTCAAAGAGAAAGCCAGTCCTTAAAATGTGATTTGGGAAGCCGTGTTTTAAAGGAAAT

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601935_chr19_23845960_-_1465nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGATCTGTGGGACAGACCCAGCAGGTGGTGCCCCATGTAA
GAAGCAATGAAATGCATCATGATGGAACCCTCAAAAACGAAAGTGAAGTTACTGCACACCCCTTAGGTCCTCTTTGGATTCCAGCATGAT
GCATCAAACCTTACCACGGCATGACTAGGGCCCAACCTGCTACCAGAAATAAAGGAAATGACGATGCAGAACCCACAACCCTGGATGATG
TGGCTTCCTTGGATGACACAGGCCCCAGACATTACCTGGGGAATGCTGAAGAACACAACTCAGGAGGCTGAACAAATCTGCTTCAGACAC
AGATACCATTCAATCCATATAATTTGTTCTTTGCTATGCTTTTTATTCCACATTGCAACTCTTATAGAATACTGATTCTTCTTATTCTCT
CTTTTTGCCTGCAACCCACACCTGCTATAAACTATTGGGCCCATCTTCTAGATCTGCCTTTCTTACGGCATTTTACTTGGGAAGGTACCC
CCTTCTCAGCCTCTGACAACGTGACCAATTGGCTGGGAGGTATTGACTTACCCCCGGTGGGGTCCCTCAGTAATGGCACACATTGGACTC
AGGTGCCAAGTAACATTACATATCAATCCTTGATTGGAAAAGAATAATATTGATTATACTCATGTTTGTCTTATGTTATTTACTGGTTCT
AGGGTGCAAAGCTGGAACACAAACTGTAACCATTGCACCAGTCAAACCTGTCGCTGCTCAGATCTGTATGCTTCAATCAACAAAACCTGA
TGCAAAAAAACAGAAAAAGGGGAGATGTGGGAGATTGGTCAGAGTGGTGGAAAAAGGATAGGGAAAGAACGCAAATTTTCTGAAATGTTG
GAAGGTCCTGCAGAGCTCCAGGGGAGAATAGCTGAAGGCAGCTGTTCTATAACCCTGAGGCAGAGAGCAAGCAGTAGGTACAAGGGAGTG
TGGAAGAATTTATCTTAAACAGGCTTATTTACTTATGTTGATCAGGAACTGACCTTTGATCATTTGCGTGTGTGACATTCCCTGAAAGGG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000600313_chr19_23845960_-_549nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTCTCCCTCTGATGCCGAGCCGAAGCTGGACTGTACTGC
TGCCATCTCTGCTCACTGCAACCTCCCTGCCTGATTCTCCTGCCTCAGCCTGCCGAGTGCCTGCGATTGCAGGTGCGCGCAGCCATGCCT

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000596211_chr19_23845960_-_587nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGCCAAAAGCAATAGCCGATTTGGATACCATCAAGACACC
TGAAACCTTATCATGAGCCAGATGCCAAGGAAGAGACTCTGGGAGGATCCCAAGGACCCCCTGGTTGCAGCCATGTCAAGACTGACACTG

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000359788_chr19_23845960_-_2317nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGTAATGTGTTCTCATTTTGCCCAAGAGTTTTGGCCAGAGC
AGAACATAAAAGATTCTTTTGAAAAAGTGACACTGAGAAGATATGAAAAATGTGGAAATGATAATTTTCAGTTAAAAGGCTGTAAAAGTG
TGGATGAATGTAAGTTGCACAAGGGAGGTTATAATGGACTTAACCAATGTTTACCAACTATGCAGAGCAAAATGTTTCAATGTGATAAAT
ATGTGAAAGTCTTTAATAAATTTTCACATTCAGATAGACATAAGATAAAACATATGGAAAATAAACCTTTCAAATGTAAAGAATGTGGCA
GATCATTTTGCATGCTTTCACACCTAACTCGACATGAAAGAAATTATACCAAGGTGAATTTCTGCAAATGTGAAGAATGTGAAAAAGCTG
TTAACCAATCTTCAAAGCTTACTAAACATAAAAGAATTTATACTTGTGAGAAACTCTACAAATGTCAAGAATGTGACAGAACTTTTAACC
AATTCTCAAACCTTACTGAATATAAAAAAGATTATGCTCGAGAGAAACCATACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTCCT
CACACCTTACTACACATAAGATAATTCATACAGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCTTTAACCAGTTCTCAAATC
TTACTACACATAAAAAAATTCATACTGGAGAGCAACCCTACATATGTGAAGAATGTGGCAAGGCTTTTACCCAATCCTCAACCCTTACTA
CACATAAGAGAATTCATACTGGAGAAAAACCCTACAAATGTGAAGAATGTGGAAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATA
AAAACATTCATACTGGAGAGCAACCCTACAAATGTGAGGAATGCGGCAAAGCTTTTAACCGATCCTCAAATCTTACGGAACATAGGAAAA
TTCATACCGAAGAGAAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTTAAACACTCCTCAGCCCTTACTACACATAAGAGAATTCACA
CTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTAACCGATCCTCAAAACTTACTGAACATAAGAAACTTCATACTGGAA
AGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTATCCAATCCTCAAAACTTACTGAACATAAGAAAATTCATTCTGGAGAGATAC
CCTACAAGTGTGAAGAATGTGGCAAAGCTTTTAAACACTCCTCATCCCTTACTACACATAAAAGAATTCATACTGGGGAGAAACCCTACA
AATGTGAAGAATGTGGCAAAGCTTTTAGCCGATCCTCAAAACTTACTGAACATAAGATAATTCATACTGGAGAGAAACCCTATAAATGTG
AGAGATGTGACAAAGCTTTTAACCAATCTGCAAACCTTACTAAACATAAAAAAATACATACTGGAGAGAAACTACAGAACTGGAATGTGT
GATAATGATTTTGACAACACCTCAAATTTTTCTAAATATAAAGGAAATCATACTGGTGAAAAATTCTAGAAATGTAAAGAATGTGTCAAA
GACTTTAAATGGTTTTCACACTTCATTGTATGTAAGATAATTCATACTGGAGAAAACTACAAGTGTGAAGAATTTGGCAATACTGTTAAT
TAAGGCTCAAACCTTATTGCACAGGAAAGCGTTTATACTTAAGAAAAATTGTACAAATATAAAGAGTGTAAAATAGCCATTAATATCTGT
TGACATCTTAATATCAGAATGTTGGTACTTAATAAAAGCATTATAAATGCAATTACTGTCTAAAGACTTTAAGAAAATATAAGCCTTTAA

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000601010_chr19_23845960_-_699nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGAGTCTCGCCCTGTCGTCCAGCCTGAAGTTCAGTGGTACA
ATCTCTGCTTACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTATAGGCACATGCCAC
CATGCCTGACTAATTTTTGTACTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAAGCTGGTCTTGAACTCCTGACCTCGTGATCCATC

>In-frame_COL4A1_ENST00000543140_chr13_110959291_-_ZNF675_ENST00000599168_chr19_23845960_-_590nt
CGGGACGGTGCGTAGCGCTGGAAGTCCGGCCTTCCGAGAGCTAGCTGTCCGCCGCGGCCCCCGCACGCCGGGCAGCCGTCCCTCGCCGCC
TCGGGCGCGCCACCATGGGGCCCCGGCTCAGCGTCTGGCTGCTGCTGCTGCCCGCCGCCCTTCTGCTCCACGAGGAGCACAGCCGGGCCG
CTGCGAAGGGACTGTTGACATTTAGGGATGTGGCCATAGAATTCTCTCTGGAAGAATGGCAATGCCTGGACACTGCACAGCGGAATTTAT
ATAAAAATGTGATTTTAGAGAACTACAGAAACCTGGTCTTCCTGGGTATTGCTGTCTCTAAGCAAGACCTGATCACCTGTCTGGAGCAAG
AAAAAGAGCCTTTGACTGTGAAGAGACATGAGATGGTGAATGAACCCCCAGGTAAGTGAGAATGAAAGTGAATACAACAGGTGACACTGA
TGAGAGGTCCAAAGGTCAAAGAGAAAGCCAGTCCTTAAAATGTGATTTGGGAAGCCGTGTTTTAAAGGAAATAATTTCTGGAAAGCCTGA


Top

FusionGenePPI for COL4A1_ZNF675


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
COL4A1DISC1, NID1, NID2, COL4A2, COL4A1, THBS1, COL7A1, MAG, VHL, PDGFA, PDGFB, ACHE, KIFAP3, PLOD1, COLGALT2, MMP9, MMP2, TINAGZNF675TRAF6, TNFSF11, IL1B, LMO4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for COL4A1_ZNF675


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for COL4A1_ZNF675


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCOL4A1C4013035BRAIN SMALL VESSEL DISEASE WITH OR WITHOUT OCULAR ANOMALIES8ORPHANET;UNIPROT
HgeneCOL4A1C1867983PORENCEPHALY, FAMILIAL3ORPHANET;UNIPROT
HgeneCOL4A1C2673195Angiopathy, Hereditary, With Nephropathy, Aneurysms, And Muscle Cramps3CTD_human;ORPHANET;UNIPROT
HgeneCOL4A1C0017668Focal glomerulosclerosis2CTD_human
HgeneCOL4A1C0011881Diabetic Nephropathy1CTD_human
HgeneCOL4A1C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneCOL4A1C0027726Nephrotic Syndrome1CTD_human
HgeneCOL4A1C0266484Schizencephaly1HPO;ORPHANET;UNIPROT
HgeneCOL4A1C3281105HEMORRHAGE, INTRACEREBRAL, SUSCEPTIBILITY TO1UNIPROT