FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7804

FusionGeneSummary for COBLL1_SMYD3

check button Fusion gene summary
Fusion gene informationFusion gene name: COBLL1_SMYD3
Fusion gene ID: 7804
HgeneTgene
Gene symbol

COBLL1

SMYD3

Gene ID

22837

64754

Gene namecordon-bleu WH2 repeat protein like 1SET and MYND domain containing 3
SynonymsCOBLR1KMT3E|ZMYND1|ZNFN3A1|bA74P14.1
Cytomap

2q24.3

1q44

Type of geneprotein-codingprotein-coding
Descriptioncordon-bleu protein-like 1COBL-like 1histone-lysine N-methyltransferase SMYD3SET and MYND domain-containing protein 3bA74P14.1 (novel protein)zinc finger MYND domain-containing protein 1zinc finger protein, subfamily 3A (MYND domain containing), 1zinc finger, MYND domain containing 1
Modification date2018052320180519
UniProtAcc

Q53SF7

Q9H7B4

Ensembl transtripts involved in fusion geneENST00000375458, ENST00000342193, 
ENST00000409184, ENST00000392717, 
ENST00000194871, ENST00000491126, 
ENST00000541742, ENST00000490107, 
ENST00000388985, ENST00000366517, 
ENST00000403792, 
Fusion gene scores* DoF score7 X 5 X 7=24517 X 9 X 13=1989
# samples 1031
** MAII scorelog2(10/245*10)=-1.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/1989*10)=-2.68170315555951
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: COBLL1 [Title/Abstract] AND SMYD3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-22-5474-01ACOBLL1chr2

165697666

-SMYD3chr1

246093239

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375458ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
In-frameENST00000375458ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
In-frameENST00000375458ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-5UTRENST00000375458ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-intronENST00000375458ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-
In-frameENST00000342193ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
In-frameENST00000342193ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
In-frameENST00000342193ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-5UTRENST00000342193ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-intronENST00000342193ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000409184ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000409184ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000409184ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-5UTRENST00000409184ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-intronENST00000409184ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000392717ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000392717ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000392717ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-5UTRENST00000392717ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-intronENST00000392717ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000194871ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000194871ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
Frame-shitENST00000194871ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-5UTRENST00000194871ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5CDS-intronENST00000194871ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5UTR-3CDSENST00000491126ENST00000541742COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5UTR-3CDSENST00000491126ENST00000490107COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5UTR-3CDSENST00000491126ENST00000388985COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5UTR-5UTRENST00000491126ENST00000366517COBLL1chr2

165697666

-SMYD3chr1

246093239

-
5UTR-intronENST00000491126ENST00000403792COBLL1chr2

165697666

-SMYD3chr1

246093239

-

Top

FusionProtFeatures for COBLL1_SMYD3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
COBLL1

Q53SF7

SMYD3

Q9H7B4

Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but notmonomethylation (PubMed:15235609, PubMed:22419068). Alsomethylates 'Lys-5' of histone H4 (PubMed:22419068). Plays animportant role in transcriptional activation as a member of an RNApolymerase complex (PubMed:15235609). Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences (PubMed:15235609).{ECO:0000269|PubMed:15235609, ECO:0000269|PubMed:22419068}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSMYD3chr2:165697666chr1:246093239ENST00000388985-412205_206177429RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr2:165697666chr1:246093239ENST00000490107-412205_206118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr2:165697666chr1:246093239ENST00000541742-412205_206118370RegionS-adenosyl-L-methionine binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000342193-1141157_1177131167DomainWH2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000375458-1131157_1177131129DomainWH2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000392717-2151157_1177511205DomainWH2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000409184-2141157_1177511167DomainWH2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000342193-114329_334131167MotifNote=KKRRAP 1
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000342193-114398_403131167MotifNote=KKRRAP 2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000375458-113329_334131129MotifNote=KKRRAP 1
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000375458-113398_403131129MotifNote=KKRRAP 2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000392717-215329_334511205MotifNote=KKRRAP 1
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000392717-215398_403511205MotifNote=KKRRAP 2
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000409184-214329_334511167MotifNote=KKRRAP 1
HgeneCOBLL1chr2:165697666chr1:246093239ENST00000409184-214398_403511167MotifNote=KKRRAP 2
TgeneSMYD3chr2:165697666chr1:246093239ENST00000388985-4124_240177429DomainSET
TgeneSMYD3chr2:165697666chr1:246093239ENST00000490107-4124_240118370DomainSET
TgeneSMYD3chr2:165697666chr1:246093239ENST00000541742-4124_240118370DomainSET
TgeneSMYD3chr2:165697666chr1:246093239ENST00000388985-41214_16177429RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr2:165697666chr1:246093239ENST00000490107-41214_16118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr2:165697666chr1:246093239ENST00000541742-41214_16118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr2:165697666chr1:246093239ENST00000388985-41249_87177429Zinc fingerMYND-type
TgeneSMYD3chr2:165697666chr1:246093239ENST00000490107-41249_87118370Zinc fingerMYND-type
TgeneSMYD3chr2:165697666chr1:246093239ENST00000541742-41249_87118370Zinc fingerMYND-type


Top

FusionGeneSequence for COBLL1_SMYD3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_265aa
MDGRTPRPQDAPARXSATLSPSVMRRCRKLVLAYIPVSLCSITAVTPTVRLCSMGPTSYCEQSETSRWERSSPSATWICXXPVRSAGSSX
GTSTALNVTVSVAKPRTRMLICXLVMSKYGRKFKNPXKKLKNXRHTGSGSRFWPCARQSXAAILNGFPISTSTSXRCSTAPWMPASTSAC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_797nt
ATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTG
GTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGC
GAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGA
GGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGA
AGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAA
GCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGT
TGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGA
TGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_1242nt
CGGCGGCGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCG
GGCTCTTGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACG
CGCCGCCTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCT
GCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACC
CCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACC
TGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGG
ACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACT
GGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGG
TGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGA
TTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAA
TGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAG
AATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACA
CACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCA

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_1240nt
CGGCGGCGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCG
GGCTCTTGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACG
CGCCGCCTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCT
GCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACC
CCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACC
TGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGG
ACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACT
GGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGG
TGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGA
TTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAA
TGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAG
AATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACA
CACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCA

>In-frame_COBLL1_ENST00000375458_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_1019nt
CGGCGGCGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCG
GGCTCTTGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACG
CGCCGCCTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCT
GCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACC
CCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACC
TGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGG
ACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACT
GGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGG
TGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGA
TTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAA
TGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAG

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000541742_chr1_246093239_-_1236nt
CGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCGGGCTCT
TGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACGCGCCGC
CTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACT
CTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACT
GTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATA
TGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGG
ATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGT
GGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCG
ACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTT
TCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGA
ATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCG
ACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCT
ATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000490107_chr1_246093239_-_1234nt
CGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCGGGCTCT
TGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACGCGCCGC
CTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACT
CTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACT
GTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATA
TGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGG
ATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGT
GGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCG
ACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTT
TCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGA
ATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCG
ACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCT
ATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCAC

>In-frame_COBLL1_ENST00000342193_chr2_165697666_-_SMYD3_ENST00000388985_chr1_246093239_-_1013nt
CGGCGCCCGCGGGCTGGGAGCCGGGGCCCGCAGGTGGAAGCGCACCCGGGAGGCGGGCCGGCCGGGGCTGGAGCGGCTCGGGCGGGCTCT
TGACGCTCAGCCAGCTTCGCTCCGGCCTCGGGAAGGCGCGCGTCCCGCCCTGACCCGCCGGCCTCTCCCACCCCAGCAGTGACGCGCCGC
CTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATGGACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGTGATCTGCAACT
CTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACT
GTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATA
TGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGG
ATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGT
GGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCG
ACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTT
TCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGA
ATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCG


Top

FusionGenePPI for COBLL1_SMYD3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
COBLL1PACSIN1, NRD1, PACSIN3, PACSIN2, AK1, DLG3, DVL2, HSP90AA1, SORT1, FGFR1OP, KIAA1107, ITGB3BP, SMEK1, CDH1, HMBOX1, AMOTL1, IFFO1, CDADC1, SCML1, UHRF1BP1L, DDHD1, FAM117A, TLK2SMYD3MEST, HELZ, POLR2A, HSP90AA1, HIST3H3, ESR1, EZH2, EED, APP, CAMK2B, NDUFAB1, NFYB, CYP39A1, VANGL1, H3F3C, TRIT1, ZNF557, CDC37, HSP90AB1, HSP90AB4P, HSP90AB3P, HSP90AA5P, MAGED4B, KDM3B, RCAN3, PLCB3, TRMT2A, KMT2E


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for COBLL1_SMYD3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for COBLL1_SMYD3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSMYD3C0236733Amphetamine-Related Disorders1CTD_human