FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7709

FusionGeneSummary for CNOT2_ERBB3

check button Fusion gene summary
Fusion gene informationFusion gene name: CNOT2_ERBB3
Fusion gene ID: 7709
HgeneTgene
Gene symbol

CNOT2

ERBB3

Gene ID

4848

2065

Gene nameCCR4-NOT transcription complex subunit 2erb-b2 receptor tyrosine kinase 3
SynonymsCDC36|HSPC131|NOT2|NOT2HErbB-3|HER3|LCCS2|MDA-BF-1|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3
Cytomap

12q15

12q13.2

Type of geneprotein-codingprotein-coding
DescriptionCCR4-NOT transcription complex subunit 2CCR4-associated factor 2negative regulator of transcription 2receptor tyrosine-protein kinase erbB-3human epidermal growth factor receptor 3proto-oncogene-like protein c-ErbB-3tyrosine kinase-type cell surface receptor HER3v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Modification date2018052320180527
UniProtAcc

Q9NZN8

P21860

Ensembl transtripts involved in fusion geneENST00000229195, ENST00000418359, 
ENST00000548230, ENST00000551483, 
ENST00000267101, ENST00000450146, 
ENST00000415288, ENST00000553131, 
ENST00000411731, ENST00000549832, 
Fusion gene scores* DoF score26 X 8 X 9=187225 X 8 X 14=2800
# samples 2525
** MAII scorelog2(25/1872*10)=-2.90458043492132
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(25/2800*10)=-3.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CNOT2 [Title/Abstract] AND ERBB3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCNOT2

GO:0000122

negative regulation of transcription by RNA polymerase II

14707134|16712523

TgeneERBB3

GO:0007162

negative regulation of cell adhesion

7556068

TgeneERBB3

GO:0007165

signal transduction

10572067

TgeneERBB3

GO:0009968

negative regulation of signal transduction

11389077

TgeneERBB3

GO:0014065

phosphatidylinositol 3-kinase signaling

7556068

TgeneERBB3

GO:0042127

regulation of cell proliferation

11389077

TgeneERBB3

GO:0051048

negative regulation of secretion

10559227


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-5856-01ACNOT2chr12

70672054

+ERBB3chr12

56493958

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000229195ENST00000267101CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000229195ENST00000450146CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000229195ENST00000415288CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000229195ENST00000553131CNOT2chr12

70672054

+ERBB3chr12

56493958

+
5CDS-intronENST00000229195ENST00000411731CNOT2chr12

70672054

+ERBB3chr12

56493958

+
5CDS-intronENST00000229195ENST00000549832CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000418359ENST00000267101CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000418359ENST00000450146CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000418359ENST00000415288CNOT2chr12

70672054

+ERBB3chr12

56493958

+
In-frameENST00000418359ENST00000553131CNOT2chr12

70672054

+ERBB3chr12

56493958

+
5CDS-intronENST00000418359ENST00000411731CNOT2chr12

70672054

+ERBB3chr12

56493958

+
5CDS-intronENST00000418359ENST00000549832CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000548230ENST00000267101CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000548230ENST00000450146CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000548230ENST00000415288CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000548230ENST00000553131CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-intronENST00000548230ENST00000411731CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-intronENST00000548230ENST00000549832CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000551483ENST00000267101CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000551483ENST00000450146CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000551483ENST00000415288CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-3CDSENST00000551483ENST00000553131CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-intronENST00000551483ENST00000411731CNOT2chr12

70672054

+ERBB3chr12

56493958

+
intron-intronENST00000551483ENST00000549832CNOT2chr12

70672054

+ERBB3chr12

56493958

+

Top

FusionProtFeatures for CNOT2_ERBB3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CNOT2

Q9NZN8

ERBB3

P21860

Component of the CCR4-NOT complex which is one of themajor cellular mRNA deadenylases and is linked to various cellularprocesses including bulk mRNA degradation, miRNA-mediatedrepression, translational repression during translationalinitiation and general transcription regulation. Additionalcomplex functions may be a consequence of its influence on mRNAexpression. Required for the CCR4-NOT complex structuralintegrity. Can repress transcription and may link the CCR4-NOTcomplex to transcriptional regulation; the repressive function mayspecifically involve the N-Cor repressor complex containing HDAC3,NCOR1 and NCOR2. Involved in the maintenance of emryonic stem (ES)cell identity. {ECO:0000269|PubMed:14707134,ECO:0000269|PubMed:16712523, ECO:0000269|PubMed:21299754,ECO:0000269|PubMed:22367759}. Tyrosine-protein kinase that plays an essential role ascell surface receptor for neuregulins. Binds to neuregulin-1(NRG1) and is activated by it; ligand-binding increasesphosphorylation on tyrosine residues and promotes its associationwith the p85 subunit of phosphatidylinositol 3-kinase(PubMed:20682778). May also be activated by CSPG5(PubMed:15358134). {ECO:0000269|PubMed:15358134,ECO:0000269|PubMed:20682778}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03709_966-55184DomainProtein kinase
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115709_966400700DomainProtein kinase
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03715_723-55184Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03788_790-55184Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03834_839-55184Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115715_723400700Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115788_790400700Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115834_839400700Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+0320_643-55184Topological domainExtracellular
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03665_1342-55184Topological domainCytoplasmic
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115665_1342400700Topological domainCytoplasmic
TgeneERBB3chr12:70672054chr12:56493958ENST00000411731+03644_664-55184TransmembraneHelical
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+1115644_664400700TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCNOT2chr12:70672054chr12:56493958ENST00000229195+216437_54016541RegionNote=Repressor domain
HgeneCNOT2chr12:70672054chr12:56493958ENST00000418359+317437_54016541RegionNote=Repressor domain
HgeneCNOT2chr12:70672054chr12:56493958ENST00000551483+17437_540-1385192RegionNote=Repressor domain
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428709_96610431343DomainProtein kinase
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529709_9669841284DomainProtein kinase
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428715_72310431343Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428788_79010431343Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428834_83910431343Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529715_7239841284Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529788_7909841284Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529834_8399841284Nucleotide bindingNote=ATP
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+242820_64310431343Topological domainExtracellular
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428665_134210431343Topological domainCytoplasmic
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+252920_6439841284Topological domainExtracellular
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529665_13429841284Topological domainCytoplasmic
TgeneERBB3chr12:70672054chr12:56493958ENST00000450146+111520_643400700Topological domainExtracellular
TgeneERBB3chr12:70672054chr12:56493958ENST00000267101+2428644_66410431343TransmembraneHelical
TgeneERBB3chr12:70672054chr12:56493958ENST00000415288+2529644_6649841284TransmembraneHelical


Top

FusionGeneSequence for CNOT2_ERBB3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_316aa
MVRTDGHTLSEKRNYQSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRS
RSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGTVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEETEYMNRRRRHS
PPHPPRPSSLEELGTEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDTETMNRQRDGGGPGGDTAAMGACPASEQGTEEMRAFQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_948nt
ATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATG
AACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATG
CCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGC
CGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCC
CCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTT
TCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGT
CCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGC
ACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACGA
GATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGG
CCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_2977nt
AACACAAACACAAACACGAACACGAACACGCTCAGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCC
GCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTCTGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGT
AACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTGAGTCGGTGGGAGACAAGACGGAGCGGCGGTAAGGGCGGTAGGGAAGTGAAGCGCCTC
TCTCCACCTTGTTAGAAGCGCGCTGAAAGCGGCCTGCCTACCCACCCCATCGCTGCCGTTTTGCAGTCGTCGCTCCCACCTTCCGCTGCC
GCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGCGGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGC
CATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGGAGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTAT
TTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTCTATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGC
CAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGC
AGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCT
GAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCC
CAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACA
CACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGAT
GAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTAC
ATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACA
ACTCCAGATGAAGACTATGAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCA
TCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGT
AGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTC
CTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGCTAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTC
CCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAATCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCA
GCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGGTTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGG
CACTCCTGGAGATATGAAGGATTACTCTCCATATCCCTTCCTCTCAGGCTCTTGACTACTTGGAACTAGGCTCTTATGTGTGCCTTTGTT
TCCCATCAGACTGTCAAGAAGAGGAAAGGGAGGAAACCTAGCAGAGGAAAGTGTAATTTTGGTTTATGACTCTTAACCCCCTAGAAAGAC
AGAAGCTTAAAATCTGTGAAGAAAGAGGTTAGGAGTAGATATTGATTACTATCATAATTCAGCACTTAACTATGAGCCAGGCATCATACT
AAACTTCACCTACATTATCTCACTTAGTCCTTTATCATCCTTAAAACAATTCTGTGACATACATATTATCTCATTTTACACAAAGGGAAG
TCGGGCATGGTGGCTCATGCCTGTAATCTCAGCACTTTGGGAGGCTGAGGCAGAAGGATTACCTGAGGCAAGGAGTTTGAGACCAGCTTA
GCCAACATAGTAAGACCCCCATCTCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAACTTTAGAACTGGGTGCAGTGGCTCATGCCTGTAA
TCCCAGCCAGCACTTTGGGAGGCTGAGATGGGAAGATCACTTGAGCCCAGAATTAGAGATAAGCCTATGGAAACATAGCAAGACACTGTC
TCTACAGGGGAAAAAAAAAAAAGAAACTGAGCCTTAAAGAGATGAAATAAATTAAGCAGTAGATCCAGGATGCAAAATCCTCCCAATTCC
TGTGCATGTGCTCTTATTGTAAGGTGCCAAGAAAAACTGATTTAAGTTACAGCCCTTGTTTAAGGGGCACTGTTTCTTGTTTTTGCACTG
AATCAAGTCTAACCCCAACAGCCACATCCTCCTATACCTAGACATCTCATCTCAGGAAGTGGTGGTGGGGGTAGTCAGAAGGAAAAATAA
CTGGACATCTTTGTGTAAACCATAATCCACATGTGCCGTAAATGATCTTCACTCCTTATCCGAGGGCAAATTCACAAGGATCCCCAAGAT
CCACTTTTAGAAGCCATTCTCATCCAGCAGTGAGAAGCTTCCAGGTAGGACAGAAAAAAGATCCAGCTTCAGCTGCACACCTCTGTCCCC
TTGGATGGGGAACTAAGGGAAAACGTCTGTTGTATCACTGAAGTTTTTTGTTTTGTTTTTATACGTGTCTGAATAAAAATGCCAAAGTTT

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_1846nt
AACACAAACACAAACACGAACACGAACACGCTCAGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCC
GCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTCTGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGT
AACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTGAGTCGGTGGGAGACAAGACGGAGCGGCGGTAAGGGCGGTAGGGAAGTGAAGCGCCTC
TCTCCACCTTGTTAGAAGCGCGCTGAAAGCGGCCTGCCTACCCACCCCATCGCTGCCGTTTTGCAGTCGTCGCTCCCACCTTCCGCTGCC
GCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGCGGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGC
CATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGGAGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTAT
TTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTCTATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGC
CAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGC
AGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCT
GAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCC
CAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACA
CACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGAT
GAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTAC
ATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACA
ACTCCAGATGAAGACTATGAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCA
TCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGT
AGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTC
CTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGCTAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTC
CCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAATCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCA
GCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGGTTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGG

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_1808nt
AACACAAACACAAACACGAACACGAACACGCTCAGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCC
GCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTCTGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGT
AACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTGAGTCGGTGGGAGACAAGACGGAGCGGCGGTAAGGGCGGTAGGGAAGTGAAGCGCCTC
TCTCCACCTTGTTAGAAGCGCGCTGAAAGCGGCCTGCCTACCCACCCCATCGCTGCCGTTTTGCAGTCGTCGCTCCCACCTTCCGCTGCC
GCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGCGGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGC
CATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGGAGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTAT
TTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTCTATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGC
CAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGC
AGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCT
GAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCC
CAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACA
CACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGAT
GAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTAC
ATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACA
ACTCCAGATGAAGACTATGAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCA
TCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGT
AGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTC
CTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGCTAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTC
CCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAATCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCA
GCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGGTTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGG

>In-frame_CNOT2_ENST00000229195_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_2278nt
AACACAAACACAAACACGAACACGAACACGCTCAGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCC
GCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTCTGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGT
AACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTGAGTCGGTGGGAGACAAGACGGAGCGGCGGTAAGGGCGGTAGGGAAGTGAAGCGCCTC
TCTCCACCTTGTTAGAAGCGCGCTGAAAGCGGCCTGCCTACCCACCCCATCGCTGCCGTTTTGCAGTCGTCGCTCCCACCTTCCGCTGCC
GCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGCGGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGC
CATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGGAGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTAT
TTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTCTATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGC
CAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGC
AGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCT
GAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCC
CAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACA
CACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGAT
GAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTAC
ATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACA
ACTCCAGATGAAGACTATGAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCA
TCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGT
AGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTC
CTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGCTAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTC
CCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAATCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCA
GCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGGTTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGG
CACTCCTGGAGATATGAAGGATTACTCTCCATATCCCTTCCTCTCAGGCTCTTGACTACTTGGAACTAGGCTCTTATGTGTGCCTTTGTT
TCCCATCAGACTGTCAAGAAGAGGAAAGGGAGGAAACCTAGCAGAGGAAAGTGTAATTTTGGTTTATGACTCTTAACCCCCTAGAAAGAC
AGAAGCTTAAAATCTGTGAAGAAAGAGGTTAGGAGTAGATATTGATTACTATCATAATTCAGCACTTAACTATGAGCCAGGCATCATACT
AAACTTCACCTACATTATCTCACTTAGTCCTTTATCATCCTTAAAACAATTCTGTGACATACATATTATCTCATTTTACACAAAGGGAAG
TCGGGCATGGTGGCTCATGCCTGTAATCTCAGCACTTTGGGAGGCTGAGGCAGAAGGATTACCTGAGGCAAGGAGTTTGAGACCAGCTTA

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000267101_chr12_56493958_+_2849nt
AGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCCGCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTC
TGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGTAACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTG
AGTCGGTGGGAGACAAGACGGAGCGGCGTCGTCGCTCCCACCTTCCGCTGCCGCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGC
GGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGG
AGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTATTTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTC
TATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCAT
GAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAAT
GCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAG
CCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTC
CCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCT
TTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAG
TCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAG
CACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACG
AGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGG
GCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGA
TTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTCCTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGC
TAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTCCCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAA
TCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCAGCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGG
TTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGGCACTCCTGGAGATATGAAGGATTACTCTCCATATCCCT
TCCTCTCAGGCTCTTGACTACTTGGAACTAGGCTCTTATGTGTGCCTTTGTTTCCCATCAGACTGTCAAGAAGAGGAAAGGGAGGAAACC
TAGCAGAGGAAAGTGTAATTTTGGTTTATGACTCTTAACCCCCTAGAAAGACAGAAGCTTAAAATCTGTGAAGAAAGAGGTTAGGAGTAG
ATATTGATTACTATCATAATTCAGCACTTAACTATGAGCCAGGCATCATACTAAACTTCACCTACATTATCTCACTTAGTCCTTTATCAT
CCTTAAAACAATTCTGTGACATACATATTATCTCATTTTACACAAAGGGAAGTCGGGCATGGTGGCTCATGCCTGTAATCTCAGCACTTT
GGGAGGCTGAGGCAGAAGGATTACCTGAGGCAAGGAGTTTGAGACCAGCTTAGCCAACATAGTAAGACCCCCATCTCTTTAAAAAAAAAA
AAAAAAAAAAAAAAAAAACTTTAGAACTGGGTGCAGTGGCTCATGCCTGTAATCCCAGCCAGCACTTTGGGAGGCTGAGATGGGAAGATC
ACTTGAGCCCAGAATTAGAGATAAGCCTATGGAAACATAGCAAGACACTGTCTCTACAGGGGAAAAAAAAAAAAGAAACTGAGCCTTAAA
GAGATGAAATAAATTAAGCAGTAGATCCAGGATGCAAAATCCTCCCAATTCCTGTGCATGTGCTCTTATTGTAAGGTGCCAAGAAAAACT
GATTTAAGTTACAGCCCTTGTTTAAGGGGCACTGTTTCTTGTTTTTGCACTGAATCAAGTCTAACCCCAACAGCCACATCCTCCTATACC
TAGACATCTCATCTCAGGAAGTGGTGGTGGGGGTAGTCAGAAGGAAAAATAACTGGACATCTTTGTGTAAACCATAATCCACATGTGCCG
TAAATGATCTTCACTCCTTATCCGAGGGCAAATTCACAAGGATCCCCAAGATCCACTTTTAGAAGCCATTCTCATCCAGCAGTGAGAAGC
TTCCAGGTAGGACAGAAAAAAGATCCAGCTTCAGCTGCACACCTCTGTCCCCTTGGATGGGGAACTAAGGGAAAACGTCTGTTGTATCAC

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000450146_chr12_56493958_+_1718nt
AGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCCGCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTC
TGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGTAACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTG
AGTCGGTGGGAGACAAGACGGAGCGGCGTCGTCGCTCCCACCTTCCGCTGCCGCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGC
GGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGG
AGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTATTTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTC
TATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCAT
GAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAAT
GCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAG
CCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTC
CCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCT
TTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAG
TCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAG
CACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACG
AGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGG
GCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGA
TTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTCCTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGC
TAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTCCCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAA
TCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCAGCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGG
TTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGGCACTCCTGGAGATATGAAGGATTACTCTCCATATCCCT

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000415288_chr12_56493958_+_1680nt
AGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCCGCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTC
TGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGTAACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTG
AGTCGGTGGGAGACAAGACGGAGCGGCGTCGTCGCTCCCACCTTCCGCTGCCGCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGC
GGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGG
AGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTATTTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTC
TATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCAT
GAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAAT
GCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAG
CCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTC
CCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCT
TTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAG
TCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAG
CACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACG
AGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGG
GCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGA
TTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTCCTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGC
TAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTCCCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAA
TCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCAGCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGG

>In-frame_CNOT2_ENST00000418359_chr12_70672054_+_ERBB3_ENST00000553131_chr12_56493958_+_2150nt
AGCGTCCCCGGGGAGGGCGGACTGAAGCCACCTCACCATTCATCGCCCCTGGACCCCGCAGTCCCCCTCGGACTCAGGGCCAGAGCCTTC
TGCGAAGCAACCTAGCCCCAGGGAAACGGTAGCGGCCGCAGAAGCCCCGCTCTCTGTAACGGCCGCGGAGGAGCAGCAAGCCTCCCTGTG
AGTCGGTGGGAGACAAGACGGAGCGGCGTCGTCGCTCCCACCTTCCGCTGCCGCCTGGAGGGAAGCCGGAGCGACGGGGGTCACGGCGGC
GGTCAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGG
AGACGTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGTGACAGTTCTATTTGATTGCCTCCGGTACTGTGAGGAAAGGACACGACTC
TATGGTGAGGACTGATGGACATACATTATCTGAGAAAAGAAACTACCAGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCAT
GAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAAT
GCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAG
CCGGAGCAGGAGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTACCCCACTCTC
CCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCT
TTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAG
TCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAG
CACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTATGAATATATGAATCGGCAACG
AGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGG
GCCTGGACATCAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGA
TTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACGTAACTCCTGCTCCCTGTGGCACTCAGGGAGCATTTAATGGCAGC
TAGTGCCTTTAGAGGGTACCGTCTTCTCCCTATTCCCTCTCTCTCCCAGGTCCCAGCCCCTTTTCCCCAGTCCCAGACAATTCCATTCAA
TCTTTGGAGGCTTTTAAACATTTTGACACAAAATTCTTATGGTATGTAGCCAGCTGTGCACTTTCTTCTCTTTCCCAACCCCAGGAAAGG
TTTTCCTTATTTTGTGTGCTTTCCCAGTCCCATTCCTCAGCTTCTTCACAGGCACTCCTGGAGATATGAAGGATTACTCTCCATATCCCT
TCCTCTCAGGCTCTTGACTACTTGGAACTAGGCTCTTATGTGTGCCTTTGTTTCCCATCAGACTGTCAAGAAGAGGAAAGGGAGGAAACC
TAGCAGAGGAAAGTGTAATTTTGGTTTATGACTCTTAACCCCCTAGAAAGACAGAAGCTTAAAATCTGTGAAGAAAGAGGTTAGGAGTAG
ATATTGATTACTATCATAATTCAGCACTTAACTATGAGCCAGGCATCATACTAAACTTCACCTACATTATCTCACTTAGTCCTTTATCAT
CCTTAAAACAATTCTGTGACATACATATTATCTCATTTTACACAAAGGGAAGTCGGGCATGGTGGCTCATGCCTGTAATCTCAGCACTTT


Top

FusionGenePPI for CNOT2_ERBB3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CNOT2CNOT3, CNOT1, DDB1, HDAC3, NCOR2, NCOR1, GPS2, VCP, CNOT6L, CNOT6, NLK, RNF219, CNOT8, MMP7, CAPZA2, CNOT7, WRAP73, AURKA, TNRC6C, TNRC6A, TNRC6B, AGO2, CAPZB, XPO1, CACNA2D1, DDX11, FHL2, EIF6, POLD1, UPF1, RPL12, MRPS12, RQCD1, USP24, LARP1, CNOT10, SS18L2, CNOT11, KANSL3, TMEM165, AKIP1, DDX24, WDR26, LCOR, TNKS1BP1, CNKSR3, RC3H1, NANOS2, TOB1, RIBC1, GADD45B, GPBP1L1, TEX13A, BTRC, KLKB1, GLA, NFKB1ERBB3GRB2, PIK3R2, CSK, SHC1, CD82, RGS4, ODF2L, GRB7, PA2G4, EGF, RNF41, NRG1, PIK3R1, IL6ST, PTK6, EGFR, MUC1, NRG2, ERBB2, RPN1, EGR1, ZNF207, HDAC6, LRIG1, MDM2, AKT1, PTPN11, HSP90AA1, NCK2, JAK2, SH2D1A, DAB1, ABL1, HCK, FGFR1, SRC, NCK1, FER, PLCG1, RASA1, TXK, ABL2, ZAP70, SYK, CRK, CRKL, JAK3, VAV2, CHN2, ITK, RIN1, BCAR3, TENC1, TNS3, TNS4, SHC3, PIK3R3, VAV1, VAV3, DAPP1, SH2B3, NEDD4, HLA-DPA1, UQCR10, B3GALTL, PDF, TUBA4A, TUBB8, HLA-A, YBEY, SLC31A1, EIF1AX, SRPK2, HLA-B, SLC25A5, SLC25A6, AIFM1, ANXA2, AP1M2, ATP5A1, B2M, C1QBP, CANX, CDC37, DNAJB11, DNAJA1, TUFM, ERBB3, GFAP, HSPA5, HNRNPH1, HNRNPH2, HNRNPF, HSP90AB1, HSPA8, LGALS3BP, MASP1, PHLDA1, PIK3CA, PIK3CB, PTCD3, RAE1, RPL23, RPS27, RPS27A, RPS27L, MRPS14, MRPS17, MRPS23, MRPS27, MRPS28, S100A10, SSR1, TUBB, ACTA2, ACTB, ACTBL2, POTEKP, ACTC1, ACTG1, ACTG2, ACTA1, HBA1, HBB, HBD, HBE1, HBG1, HBG2, HNRNPH3, HSPA1A, LRPPRC, PON2, POTEE, POTEF, HNRNPA2B1, HNRNPAB, MRPS18B, MRPS22, MRPS25, MRPS26, MRPS34, TUBA1B, PCGF1, DPPA4, NANOG, POU5F1, EPN1, L1CAM, MET, NEDD4L, PTK2B, NDRG1, CDH1, PTPRH, UQCRH, PPM1A, PPM1B, PPM1F, PPM1K, PPM1M, ILKAP, PTPRR, PTPN6, PTPN7, PTPN12, PTPN20B, DUSP14, DUSP18, DUSP19, DUSP21, DUPD1, STYX, PTPDC1, PTEN, TPTE, MTMR1, MTMR2, MTMR6, MTMR8, MTMR9, MTMR10, CDC25C, EYA4, CSPG5, HGS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CNOT2_ERBB3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CNOT2_ERBB3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneERBB3C0036341Schizophrenia3PSYGENET
TgeneERBB3C0005586Bipolar Disorder1PSYGENET
TgeneERBB3C0011570Mental Depression1PSYGENET
TgeneERBB3C0016978gallbladder neoplasm1CTD_human
TgeneERBB3C0024121Lung Neoplasms1CTD_human
TgeneERBB3C0033578Prostatic Neoplasms1CTD_human
TgeneERBB3C0041696Unipolar Depression1PSYGENET
TgeneERBB3C1269683Major Depressive Disorder1PSYGENET
TgeneERBB3C1458155Mammary Neoplasms1CTD_human
TgeneERBB3C2931822Nasopharyngeal carcinoma1CTD_human