FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 757

FusionGeneSummary for ADAMTS7_TMEM135

check button Fusion gene summary
Fusion gene informationFusion gene name: ADAMTS7_TMEM135
Fusion gene ID: 757
HgeneTgene
Gene symbol

ADAMTS7

TMEM135

Gene ID

11173

65084

Gene nameADAM metallopeptidase with thrombospondin type 1 motif 7transmembrane protein 135
SynonymsADAM-TS 7|ADAM-TS7|ADAMTS-7PMP52
Cytomap

15q25.1

11q14.2

Type of geneprotein-codingprotein-coding
DescriptionA disintegrin and metalloproteinase with thrombospondin motifs 7COMPasea disintegrin and metalloprotease with thrombospondin motifs-7 preproproteina disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7transmembrane protein 135peroxisomal membrane protein 52
Modification date2018052220180519
UniProtAcc

Q9UKP4

Q86UB9

Ensembl transtripts involved in fusion geneENST00000388820, ENST00000566303, 
ENST00000340353, ENST00000532959, 
ENST00000305494, ENST00000535167, 
ENST00000355734, 
Fusion gene scores* DoF score2 X 2 X 2=88 X 6 X 7=336
# samples 210
** MAII scorelog2(2/8*10)=1.32192809488736log2(10/336*10)=-1.74846123300404
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ADAMTS7 [Title/Abstract] AND TMEM135 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneADAMTS7

GO:0032331

negative regulation of chondrocyte differentiation

22247065

HgeneADAMTS7

GO:0071773

cellular response to BMP stimulus

22247065


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A3ET-06AADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000388820ENST00000340353ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
In-frameENST00000388820ENST00000532959ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
In-frameENST00000388820ENST00000305494ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
In-frameENST00000388820ENST00000535167ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5CDS-intronENST00000388820ENST00000355734ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5UTR-3CDSENST00000566303ENST00000340353ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5UTR-3CDSENST00000566303ENST00000532959ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5UTR-3CDSENST00000566303ENST00000305494ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5UTR-3CDSENST00000566303ENST00000535167ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+
5UTR-intronENST00000566303ENST00000355734ADAMTS7chr15

79103463

-TMEM135chr11

86947680

+

Top

FusionProtFeatures for ADAMTS7_TMEM135


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ADAMTS7

Q9UKP4

TMEM135

Q86UB9

Metalloprotease that may play a role in the degradationof COMP. {ECO:0000269|PubMed:16585064}. Involved in mitochondrial metabolism by regulating thebalance between mitochondrial fusion and fission. May act as aregulator of mitochondrial fission that promotes DNM1L-dependentfission through activation of DNM1L. May be involved in peroxisomeorganization. {ECO:0000250|UniProtKB:Q5U4F4,ECO:0000250|UniProtKB:Q9CYV5}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+415298_318154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+415331_351154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+415380_400154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+314149_169132437TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+314298_318132437TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+314331_351132437TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+314380_400132437TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124595_697331687Compositional biasNote=Cys-rich
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-1241411_1459331687DomainTSP type-1 5
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-1241462_1522331687DomainTSP type-1 6
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-1241523_1567331687DomainTSP type-1 7
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-1241569_1629331687DomainTSP type-1 8
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-1241632_1672331687DomainPLAC
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124242_452331687DomainPeptidase M12B
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124462_537331687DomainNote=Disintegrin
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124538_593331687DomainTSP type-1 1
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124821_880331687DomainTSP type-1 2
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124881_940331687DomainTSP type-1 3
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124942_995331687DomainTSP type-1 4
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124202_209331687MotifCysteine switch
HgeneADAMTS7chr15:79103463chr11:86947680ENST00000388820-124698_809331687RegionNote=Spacer
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+415149_169154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+41568_88154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000305494+41596_116154459TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+31468_88132437TransmembraneHelical
TgeneTMEM135chr15:79103463chr11:86947680ENST00000340353+31496_116132437TransmembraneHelical


Top

FusionGeneSequence for ADAMTS7_TMEM135


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000340353_chr11_86947680_+_338aa
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGPFVLHHSCHVHVLFQVQGWLERIYIFCTXVHCREGRNSHTFFFTRGSICKSGTKER
ATXGKTRKNEYDWSSQEICGFNMQTWTKAXMLQTLXRXLHLLLHXRFHQNVXRGVLDPVLPPNPFCIXASVYTAISATFSLLQXRKLPAW
SFSWLFCXYIQGYXLLPALDQKLRXXTTCYYSWIFGRYINDVLXKHNNFHVFSVQIGRDNVFQRHXSREGSLFSSCRYYHLFHLYSNLLP

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000532959_chr11_86947680_+_338aa
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGPFVLHHSCHVHVLFQVQGWLERIYIFCTXVHCREGRNSHTFFFTRGSICKSGTKER
ATXGKTRKNEYDWSSQEICGFNMQTWTKAXMLQTLXRXLHLLLHXRFHQNVXRGVLDPVLPPNPFCIXASVYTAISATFSLLQXRKLPAW
SFSWLFCXYIQGYXLLPALDQKLRXXTTCYYSWIFGRYINDVLXKHNNFHVFSVQIGRDNVFQRHXSREGSLFSSCRYYHLFHLYSNLLP

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000305494_chr11_86947680_+_338aa
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGPFVLHHSCHVHVLFQVQGWLERIYIFCTXVHCREGRNSHTFFFTRGSICKSGTKER
ATXGKTRKNEYDWSSQEICGFNMQTWTKAXMLQTLXRXLHLLLHXRFHQNVXRGVLDPVLPPNPFCIXASVYTAISATFSLLQXRKLPAW
SFSWLFCXYIQGYXLLPALDQKLRXXTTCYYSWIFGRYINDVLXKHNNFHVFSVQIGRDNVFQRHXSREGSLFSSCRYYHLFHLYSNLLP

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000535167_chr11_86947680_+_338aa
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGPFVLHHSCHVHVLFQVQGWLERIYIFCTXVHCREGRNSHTFFFTRGSICKSGTKER
ATXGKTRKNEYDWSSQEICGFNMQTWTKAXMLQTLXRXLHLLLHXRFHQNVXRGVLDPVLPPNPFCIXASVYTAISATFSLLQXRKLPAW
SFSWLFCXYIQGYXLLPALDQKLRXXTTCYYSWIFGRYINDVLXKHNNFHVFSVQIGRDNVFQRHXSREGSLFSSCRYYHLFHLYSNLLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000340353_chr11_86947680_+_1015nt
ATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCTCCTCTGCGCTCTGGCTCCCGGCGCCCCCGGA
CCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGTGCAAGGATGGCTTGAAAGGATTTACATTTTC
TGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGGCAGCATATGCAAAAGTGGAACAAAAGAGAGA
GCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGGATTCAATATGCAAACATGGACCAAGGCATAG
ATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAATGTTTAGCGTGGGGTACTTGATCCAGTGCTG
CCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTCTCTTCTACAATAAAGAAAACTTCCAGCTTGG
AGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGATCAGAAACTTAGATGATGAACTACATGCTAT
TATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCATGTATTTAGCGTCCAAATTGGTAGAGACAAT
GTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCATCTATTCCATCTCTACAGCAATTTGCTTCCA
GGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGACTCACCAAGGGCAAATTTGCTGTCATGAACCG
AAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCAGGTTGGATCCAAGATACACAACTGTAACACC

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000532959_chr11_86947680_+_1015nt
ATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCTCCTCTGCGCTCTGGCTCCCGGCGCCCCCGGA
CCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGTGCAAGGATGGCTTGAAAGGATTTACATTTTC
TGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGGCAGCATATGCAAAAGTGGAACAAAAGAGAGA
GCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGGATTCAATATGCAAACATGGACCAAGGCATAG
ATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAATGTTTAGCGTGGGGTACTTGATCCAGTGCTG
CCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTCTCTTCTACAATAAAGAAAACTTCCAGCTTGG
AGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGATCAGAAACTTAGATGATGAACTACATGCTAT
TATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCATGTATTTAGCGTCCAAATTGGTAGAGACAAT
GTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCATCTATTCCATCTCTACAGCAATTTGCTTCCA
GGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGACTCACCAAGGGCAAATTTGCTGTCATGAACCG
AAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCAGGTTGGATCCAAGATACACAACTGTAACACC

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000305494_chr11_86947680_+_1015nt
ATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCTCCTCTGCGCTCTGGCTCCCGGCGCCCCCGGA
CCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGTGCAAGGATGGCTTGAAAGGATTTACATTTTC
TGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGGCAGCATATGCAAAAGTGGAACAAAAGAGAGA
GCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGGATTCAATATGCAAACATGGACCAAGGCATAG
ATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAATGTTTAGCGTGGGGTACTTGATCCAGTGCTG
CCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTCTCTTCTACAATAAAGAAAACTTCCAGCTTGG
AGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGATCAGAAACTTAGATGATGAACTACATGCTAT
TATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCATGTATTTAGCGTCCAAATTGGTAGAGACAAT
GTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCATCTATTCCATCTCTACAGCAATTTGCTTCCA
GGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGACTCACCAAGGGCAAATTTGCTGTCATGAACCG
AAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCAGGTTGGATCCAAGATACACAACTGTAACACC

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000535167_chr11_86947680_+_1015nt
ATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCTCCTCTGCGCTCTGGCTCCCGGCGCCCCCGGA
CCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGTGCAAGGATGGCTTGAAAGGATTTACATTTTC
TGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGGCAGCATATGCAAAAGTGGAACAAAAGAGAGA
GCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGGATTCAATATGCAAACATGGACCAAGGCATAG
ATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAATGTTTAGCGTGGGGTACTTGATCCAGTGCTG
CCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTCTCTTCTACAATAAAGAAAACTTCCAGCTTGG
AGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGATCAGAAACTTAGATGATGAACTACATGCTAT
TATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCATGTATTTAGCGTCCAAATTGGTAGAGACAAT
GTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCATCTATTCCATCTCTACAGCAATTTGCTTCCA
GGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGACTCACCAAGGGCAAATTTGCTGTCATGAACCG
AAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCAGGTTGGATCCAAGATACACAACTGTAACACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000340353_chr11_86947680_+_3651nt
CTTTTCTTTGCCTCTGCAGCGGCCAAGGGGGCGGGCCCTGCAGCCTTTGTTGCCCGCGGACCGAGCGCAGCCGAACGGAGTCGGGGCCGG
GTCGCCGGGAGCTGCACGCCGGCCGGGCATGTCCTGAGCCGGACCTGGGACCAGGCAGCGACCGGACGGGACGGACGAGAGCGTGCGCGC
GGGGTCACCCGGCGGCCGCCCGGTTCCTGCCATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCT
CCTCTGCGCTCTGGCTCCCGGCGCCCCCGGACCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGT
GCAAGGATGGCTTGAAAGGATTTACATTTTCTGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGG
CAGCATATGCAAAAGTGGAACAAAAGAGAGAGCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGG
ATTCAATATGCAAACATGGACCAAGGCATAGATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAA
TGTTTAGCGTGGGGTACTTGATCCAGTGCTGCCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTC
TCTTCTACAATAAAGAAAACTTCCAGCTTGGAGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGA
TCAGAAACTTAGATGATGAACTACATGCTATTATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCA
TGTATTTAGCGTCCAAATTGGTAGAGACAATGTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCA
TCTATTCCATCTCTACAGCAATTTGCTTCCAGGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGAC
TCACCAAGGGCAAATTTGCTGTCATGAACCGAAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCA
GGTTGGATCCAAGATACACAACTGTAACACCAGAGTTGCCCACAGAGTTTTCCTGAAGATGACTGTAACTTATTAATGTGACTAAATGTT
TCATCTTGAAGAGTTAATTATGTTGAACACAAAGGAGGGGGCCCAAGCTCGAACTTCAGTGTTATTTCAGTTAGAGATACTCTTTTCATT
TGTTTTGTTTTTCTTATGAATCAGAAATTCAGAAGCTTTTTAGGAAGATGTTGCTTAATAATTAAGCTTCCTCCATAGCCAGAATAAGAT
TCTGGATCACTGTAGTGACTGACATTATATATTATTGATCAAATTATGTCCACAAGCAATATTATATAATCTACGTAGAAGTGTAATAAC
AAACAAGAGTACACTTAAAATTACTTTAAAAGATGTCTTTAGTTCATTCCAATATAATTCTTGATTAAAATTAGGATTATTTCTACATTT
TAGGATTTACAAAGGATCACGGGTACATGGATTTGGTCTATATATTTTTTTAAAGTTTTGAATTGGTATCTGTAGTAGTGGAATGTTATA
GATTTGAAGTAACTCTCCACGGACAGTGCTGCTTTCGTGTAGAGCAATTTAATTGGAGAAGTGGCCATTCTTACTTCAGGGATGCAAAGA
TGGGTCTCATACCATTTGGATAAATGTCGTGGTATCCATGCTTTTTTTCAACTAATAACATCATCTCTCTTCATGACCAGTTAATTGGGC
TATTTGGCAGCCCAGTGAACCTATGTACTAATGGCAAGTTAGGGGCAAATGGAAATGGACACATCCGATAAAGTTGAAATGTATGTTTTA
ATCTTTCACAGAAGTATTACACTTGAATATTTAAAAACAAAACTTTTAAACTTCCTATAGGTTTATGATGTTTGTTTTCATTTATATGGA
CATAATCCTTCATAGCTCAGTTTATATGCCATTGTTGTATTAGAAGGGATCAAAATCCTATGGAACAAAGTAGTCTTGGCAAGTTGGCAG
TTTGTGTCCTCTCAGCTGTTTAACTTATGTAATGGATGTTTTGCACCTGAAAACACTATAAAAATCCAGTGGTTGTTTAAAAAGTCCATT
TGTCACTAATTCCATTCAGGTTCTCCAACCTTCTTCTTGAATATCATTGTCACCATTTTTACTGTTAGAATAAAGAGGTGACACCATAAA
GTCCTGCTGATAATGAGAGTAGTTCAGGACAGCTGTGATTGAAATATGGTCGCTATTTACAGTTTTTCAGGGAAAAGTTATACTTTTCTA
TGTTAATAAAGAGCTGAAGTGGTCTACAGTTAATGTGACATGTAGGGATGATGATATTTTTAAAATACATTTTGTTGCTAAAAAGTTTTT
AGGCCAGTGCAAATTATGCAGTAGAACTTGTGTTGCAAAAGGAATTATAACCCATACTTTAAAAATGCTTAATCCCTCATATTCAATTTC
ATCAAGCCTTGTATACTTCTGCTTAAATGTAATTCAATCCTTGGTTGTTATGGCAAACAGAAACCCAACAAAAAGACAGACTCTGGTACT
ATGGTAACAGAGCCACTTTATCATTTGGTCAAAATTTGGCATTATGATTAGCTTTGTAGAACTGACCTGTTTATTTGGCAATGCTGTTAA
AGGATCATTTCGGTTTCAGACTTCAAAGTTGATTAATAAATTTAATCTTAACTTTTTATTCACTGGAATCAAAACGATGGTTGGTACTGT
GTTTACTGTTTAAAATGAAGTACTAAAGCCCTGAGAACTGCACCTCATTTTCTTTATCCAGAAATTGTGCTTATATATTTTCCTGTCAGG
TTTAAAAAGATGTTTTAATTCATAAATTATTGTTTTCATTGACATTAAAAGACTGTGATATTGAAAGATGAATTACGAAATTTGCTGAGA
TTGTTTAGTAAAATTTTGCTGGTCAAAAAGGTGTATTTCTACAATTTACCTTTTCATTTTTATAAATTGCAGTCATTTTTTTAAATTTTA
TGTAAAATGTAAAATGAAATAGCTATCATGAAGCAGAATACAATGATGAATGTATAGGTTGAGTGAATAACCAATTTGCAGTGGTGGATT
GAGAAGTCCAGTTTGATTTCATTGGGACAGACTGCAAAGTGTAGTTGTTTGAGCAAACACAAAGAAACTTTGTGTTTTTGAAGACAATCA
GAATGATTACCTTTCTACCTCTAACTAATCAGGTATTGATTGACAACTTTTTGGCATTATAAATAAAGTAAAATAGATCTCTGCATTCCA
AAATATGTTTTTTAGTTTATTTATATCCTGAAGAAATGGTAAGTTTTCACTGGAACTGATTACAGTAAACAATAATATGTCCCCTTAGTC
TTTCTGACATTTTTATATAGATTGAGATTGAAAAACCGTGCATTTGGGGCAGTGGTATTATGGTCATTTCGTTGCTATTTTCTGTTTTAA

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000532959_chr11_86947680_+_1252nt
CTTTTCTTTGCCTCTGCAGCGGCCAAGGGGGCGGGCCCTGCAGCCTTTGTTGCCCGCGGACCGAGCGCAGCCGAACGGAGTCGGGGCCGG
GTCGCCGGGAGCTGCACGCCGGCCGGGCATGTCCTGAGCCGGACCTGGGACCAGGCAGCGACCGGACGGGACGGACGAGAGCGTGCGCGC
GGGGTCACCCGGCGGCCGCCCGGTTCCTGCCATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCT
CCTCTGCGCTCTGGCTCCCGGCGCCCCCGGACCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGT
GCAAGGATGGCTTGAAAGGATTTACATTTTCTGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGG
CAGCATATGCAAAAGTGGAACAAAAGAGAGAGCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGG
ATTCAATATGCAAACATGGACCAAGGCATAGATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAA
TGTTTAGCGTGGGGTACTTGATCCAGTGCTGCCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTC
TCTTCTACAATAAAGAAAACTTCCAGCTTGGAGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGA
TCAGAAACTTAGATGATGAACTACATGCTATTATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCA
TGTATTTAGCGTCCAAATTGGTAGAGACAATGTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCA
TCTATTCCATCTCTACAGCAATTTGCTTCCAGGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGAC
TCACCAAGGGCAAATTTGCTGTCATGAACCGAAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCA

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000305494_chr11_86947680_+_2243nt
CTTTTCTTTGCCTCTGCAGCGGCCAAGGGGGCGGGCCCTGCAGCCTTTGTTGCCCGCGGACCGAGCGCAGCCGAACGGAGTCGGGGCCGG
GTCGCCGGGAGCTGCACGCCGGCCGGGCATGTCCTGAGCCGGACCTGGGACCAGGCAGCGACCGGACGGGACGGACGAGAGCGTGCGCGC
GGGGTCACCCGGCGGCCGCCCGGTTCCTGCCATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCT
CCTCTGCGCTCTGGCTCCCGGCGCCCCCGGACCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGT
GCAAGGATGGCTTGAAAGGATTTACATTTTCTGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGG
CAGCATATGCAAAAGTGGAACAAAAGAGAGAGCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGG
ATTCAATATGCAAACATGGACCAAGGCATAGATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAA
TGTTTAGCGTGGGGTACTTGATCCAGTGCTGCCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTC
TCTTCTACAATAAAGAAAACTTCCAGCTTGGAGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGA
TCAGAAACTTAGATGATGAACTACATGCTATTATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCA
TGTATTTAGCGTCCAAATTGGTAGAGACAATGTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCA
TCTATTCCATCTCTACAGCAATTTGCTTCCAGGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGAC
TCACCAAGGGCAAATTTGCTGTCATGAACCGAAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCA
GGTTGGATCCAAGATACACAACTGTAACACCAGAGTTGCCCACAGAGTTTTCCTGAAGATGACTGTAACTTATTAATGTGACTAAATGTT
TCATCTTGAAGAGTTAATTATGTTGAACACAAAGGAGGGGGCCCAAGCTCGAACTTCAGTGTTATTTCAGTTAGAGATACTCTTTTCATT
TGTTTTGTTTTTCTTATGAATCAGAAATTCAGAAGCTTTTTAGGAAGATGTTGCTTAATAATTAAGCTTCCTCCATAGCCAGAATAAGAT
TCTGGATCACTGTAGTGACTGACATTATATATTATTGATCAAATTATGTCCACAAGCAATATTATATAATCTACGTAGAAGTGTAATAAC
AAACAAGAGTACACTTAAAATTACTTTAAAAGATGTCTTTAGTTCATTCCAATATAATTCTTGATTAAAATTAGGATTATTTCTACATTT
TAGGATTTACAAAGGATCACGGGTACATGGATTTGGTCTATATATTTTTTTAAAGTTTTGAATTGGTATCTGTAGTAGTGGAATGTTATA
GATTTGAAGTAACTCTCCACGGACAGTGCTGCTTTCGTGTAGAGCAATTTAATTGGAGAAGTGGCCATTCTTACTTCAGGGATGCAAAGA
TGGGTCTCATACCATTTGGATAAATGTCGTGGTATCCATGCTTTTTTTCAACTAATAACATCATCTCTCTTCATGACCAGTTAATTGGGC
TATTTGGCAGCCCAGTGAACCTATGTACTAATGGCAAGTTAGGGGCAAATGGAAATGGACACATCCGATAAAGTTGAAATGTATGTTTTA
ATCTTTCACAGAAGTATTACACTTGAATATTTAAAAACAAAACTTTTAAACTTCCTATAGGTTTATGATGTTTGTTTTCATTTATATGGA
CATAATCCTTCATAGCTCAGTTTATATGCCATTGTTGTATTAGAAGGGATCAAAATCCTATGGAACAAAGTAGTCTTGGCAAGTTGGCAG

>In-frame_ADAMTS7_ENST00000388820_chr15_79103463_-_TMEM135_ENST00000535167_chr11_86947680_+_1379nt
CTTTTCTTTGCCTCTGCAGCGGCCAAGGGGGCGGGCCCTGCAGCCTTTGTTGCCCGCGGACCGAGCGCAGCCGAACGGAGTCGGGGCCGG
GTCGCCGGGAGCTGCACGCCGGCCGGGCATGTCCTGAGCCGGACCTGGGACCAGGCAGCGACCGGACGGGACGGACGAGAGCGTGCGCGC
GGGGTCACCCGGCGGCCGCCCGGTTCCTGCCATGCCCGGCGGCCCCAGTCCCCGCAGCCCCGCGCCTTTGCTGCGCCCCCTCCTCCTGCT
CCTCTGCGCTCTGGCTCCCGGCGCCCCCGGACCCGCACCAGGTCCTTTTGTTTTGCATCACAGCTGCCATGTACATGTTCTTTTTCAGGT
GCAAGGATGGCTTGAAAGGATTTACATTTTCTGCACTTAGGTTCATTGTAGGGAAGGAAGAAATTCCCACACATTCTTTTTCACCAGAGG
CAGCATATGCAAAAGTGGAACAAAAGAGAGAGCAACATGAGGAAAAACCCGGAAGAATGAATATGATTGGTCTAGTCAGGAAATTTGTGG
ATTCAATATGCAAACATGGACCAAGGCATAGATGTTGCAAACATTATGAAGATAATTGCATCTCTTATTGCATTAAAGGTTTCATCAGAA
TGTTTAGCGTGGGGTACTTGATCCAGTGCTGCCTCCGAATCCCTTCTGCATTTAGGCATCTGTTTACACAGCCATCTCGGCTACTTTCTC
TCTTCTACAATAAAGAAAACTTCCAGCTTGGAGCTTTTCTTGGCTCTTTTGTTAGTATATACAAGGGTACTAGTTGCTTCCTGCGCTGGA
TCAGAAACTTAGATGATGAACTACATGCTATTATAGCTGGATTTTTGGCAGGTATATCAATGATGTTTTATAAAAGCACAACAATTTCCA
TGTATTTAGCGTCCAAATTGGTAGAGACAATGTATTTCAAAGGCATTGAAGCAGGGAAGGTTCCCTATTTTCCTCATGCAGATACTATCA
TCTATTCCATCTCTACAGCAATTTGCTTCCAGGCAGCTGTCATGGAAGTTCAGACTTTGAGACCATCTTACTGGAAGTTCCTTTTAAGAC
TCACCAAGGGCAAATTTGCTGTCATGAACCGAAAAGTCCTTGATGTTTTTGGTACTGGTGCATCTAAACACTTTCAGGATTTCATCCCCA
GGTTGGATCCAAGATACACAACTGTAACACCAGAGTTGCCCACAGAGTTTTCCTGAAGATGACTGTAACTTATTAATGTGACTAAATGTT
TCATCTTGAAGAGTTAATTATGTTGAACACAAAGGAGGGGGCCCAAGCTCGAACTTCAGTGTTATTTCAGTTAGAGATACTCTTTTCATT


Top

FusionGenePPI for ADAMTS7_TMEM135


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ADAMTS7TMEM135SMPD3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ADAMTS7_TMEM135


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ADAMTS7_TMEM135


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneADAMTS7C0032460Polycystic Ovary Syndrome1CTD_human
HgeneADAMTS7C1956346Coronary Artery Disease1CTD_human
TgeneTMEM135C3714756Intellectual Disability1CTD_human