FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7535

FusionGeneSummary for CLTC_EPB41L3

check button Fusion gene summary
Fusion gene informationFusion gene name: CLTC_EPB41L3
Fusion gene ID: 7535
HgeneTgene
Gene symbol

CLTC

EPB41L3

Gene ID

1213

23136

Gene nameclathrin heavy chainerythrocyte membrane protein band 4.1 like 3
SynonymsCHC|CHC17|CLH-17|CLTCL2|Hc|MRD564.1B|DAL-1|DAL1
Cytomap

17q23.1

18p11.31

Type of geneprotein-codingprotein-coding
Descriptionclathrin heavy chain 1clathrin heavy chain on chromosome 17clathrin, heavy polypeptide (Hc)clathrin, heavy polypeptide-like 2band 4.1-like protein 3differentially expressed in adenocarcinoma of the lung protein 1
Modification date2018052320180523
UniProtAcc

Q00610

Q9Y2J2

Ensembl transtripts involved in fusion geneENST00000393043, ENST00000269122, 
ENST00000579456, ENST00000579815, 
ENST00000341928, ENST00000544123, 
ENST00000540638, ENST00000342933, 
ENST00000400111, ENST00000542652, 
ENST00000427684, ENST00000542146, 
Fusion gene scores* DoF score14 X 8 X 8=8963 X 3 X 3=27
# samples 143
** MAII scorelog2(14/896*10)=-2.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CLTC [Title/Abstract] AND EPB41L3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCLTC

GO:1900126

negative regulation of hyaluronan biosynthetic process

24251095


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A0HB-01ACLTCchr17

57697534

+EPB41L3chr18

5397425

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393043ENST00000341928CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000393043ENST00000544123CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000393043ENST00000540638CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000393043ENST00000342933CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000393043ENST00000400111CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000393043ENST00000542652CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000393043ENST00000427684CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000393043ENST00000542146CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000269122ENST00000341928CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000269122ENST00000544123CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000269122ENST00000540638CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000269122ENST00000342933CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000269122ENST00000400111CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000269122ENST00000542652CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000269122ENST00000427684CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000269122ENST00000542146CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000579456ENST00000341928CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000579456ENST00000544123CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000579456ENST00000540638CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000579456ENST00000342933CLTCchr17

57697534

+EPB41L3chr18

5397425

-
In-frameENST00000579456ENST00000400111CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000579456ENST00000542652CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000579456ENST00000427684CLTCchr17

57697534

+EPB41L3chr18

5397425

-
5CDS-5UTRENST00000579456ENST00000542146CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-3CDSENST00000579815ENST00000341928CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-3CDSENST00000579815ENST00000544123CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-3CDSENST00000579815ENST00000540638CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-3CDSENST00000579815ENST00000342933CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-3CDSENST00000579815ENST00000400111CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-5UTRENST00000579815ENST00000542652CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-5UTRENST00000579815ENST00000427684CLTCchr17

57697534

+EPB41L3chr18

5397425

-
intron-5UTRENST00000579815ENST00000542146CLTCchr17

57697534

+EPB41L3chr18

5397425

-

Top

FusionProtFeatures for CLTC_EPB41L3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLTC

Q00610

EPB41L3

Q9Y2J2

Clathrin is the major protein of the polyhedral coat ofcoated pits and vesicles. Two different adapter protein complexeslink the clathrin lattice either to the plasma membrane or to thetrans-Golgi network. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization ofkinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge (PubMed:15858577, PubMed:16968737,PubMed:21297582). The TACC3/ch-TOG/clathrin complex is requiredfor the maintenance of kinetochore fiber tension(PubMed:23532825). Plays a role in early autophagosome formation(PubMed:20639872). {ECO:0000269|PubMed:15858577,ECO:0000269|PubMed:16968737, ECO:0000269|PubMed:20639872,ECO:0000269|PubMed:21297582, ECO:0000269|PubMed:23532825}. Tumor suppressor that inhibits cell proliferation andpromotes apoptosis. Modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5.{ECO:0000269|PubMed:15334060, ECO:0000269|PubMed:15737618,ECO:0000269|PubMed:16420693, ECO:0000269|PubMed:9892180}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000341928-1623861_10838241317RegionNote=C-terminal (CTD)
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000342933-1622861_10838241088RegionNote=C-terminal (CTD)
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000400111-1319861_1083602866RegionNote=C-terminal (CTD)
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000540638-1320861_1083602846RegionNote=C-terminal (CTD)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132108_149141676RegionNote=WD40-like repeat 3
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1321213_1522141676RegionInvolved in binding clathrin light chain
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132150_195141676RegionNote=WD40-like repeat 4
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1321550_1675141676RegionTrimerization
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132196_257141676RegionNote=WD40-like repeat 5
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+13224_67141676RegionNote=WD40-like repeat 1
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132258_301141676RegionNote=WD40-like repeat 6
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1322_479141676RegionNote=Globular terminal domain
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132302_330141676RegionNote=WD40-like repeat 7
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132449_465141676RegionBinding site for the uncoating ATPase%2C involved in lattice disassembly
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132480_523141676RegionNote=Flexible linker
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132524_1675141676RegionNote=Heavy chain arm
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132524_634141676RegionNote=Distal segment
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132639_1675141676RegionNote=Proximal segment
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+13268_107141676RegionNote=WD40-like repeat 2
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131108_149141640RegionNote=WD40-like repeat 3
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1311213_1522141640RegionInvolved in binding clathrin light chain
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131150_195141640RegionNote=WD40-like repeat 4
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1311550_1675141640RegionTrimerization
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131196_257141640RegionNote=WD40-like repeat 5
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+13124_67141640RegionNote=WD40-like repeat 1
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131258_301141640RegionNote=WD40-like repeat 6
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1312_479141640RegionNote=Globular terminal domain
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131302_330141640RegionNote=WD40-like repeat 7
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131449_465141640RegionBinding site for the uncoating ATPase%2C involved in lattice disassembly
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131480_523141640RegionNote=Flexible linker
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131524_1675141640RegionNote=Heavy chain arm
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131524_634141640RegionNote=Distal segment
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131639_1675141640RegionNote=Proximal segment
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+13168_107141640RegionNote=WD40-like repeat 2
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1321128_1269141676RepeatCHCR 5
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1321274_1420141676RepeatCHCR 6
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+1321423_1566141676RepeatCHCR 7
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132537_683141676RepeatCHCR 1
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132686_828141676RepeatCHCR 2
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132833_972141676RepeatCHCR 3
HgeneCLTCchr17:57697534chr18:5397425ENST00000269122+132979_1124141676RepeatCHCR 4
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1311128_1269141640RepeatCHCR 5
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1311274_1420141640RepeatCHCR 6
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+1311423_1566141640RepeatCHCR 7
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131537_683141640RepeatCHCR 1
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131686_828141640RepeatCHCR 2
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131833_972141640RepeatCHCR 3
HgeneCLTCchr17:57697534chr18:5397425ENST00000393043+131979_1124141640RepeatCHCR 4
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000341928-1623110_3918241317DomainFERM
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000342933-1622110_3918241088DomainFERM
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000400111-1319110_391602866DomainFERM
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000540638-1320110_391602846DomainFERM
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000341928-1623394_5138241317RegionNote=Hydrophilic
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000341928-1623514_8608241317RegionSpectrin--actin-binding
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000342933-1622394_5138241088RegionNote=Hydrophilic
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000342933-1622514_8608241088RegionSpectrin--actin-binding
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000400111-1319394_513602866RegionNote=Hydrophilic
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000400111-1319514_860602866RegionSpectrin--actin-binding
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000540638-1320394_513602846RegionNote=Hydrophilic
TgeneEPB41L3chr17:57697534chr18:5397425ENST00000540638-1320514_860602846RegionSpectrin--actin-binding


Top

FusionGeneSequence for CLTC_EPB41L3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_243aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_243aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_243aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_278aa
MAQILPIRFQEHLQKMETKTESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYESS
QVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_729nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_729nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_729nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_834nt
ATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACCCACC
GTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGATGCT
TCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGAGGGG
GCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGAGCAG
AGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGGCAGT
GTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATCATCA
CAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCACTACG
CACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCATGAC
CAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGAGATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_2209nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA
GATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGC
CTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAA
GACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAA
GAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAA
CACATAAACAATTCATGCCTTTCATAGTTTATTATTATTAAAGTCTAAACAAAATTGCAATTTCTTAGGTAACCTTATATTTACAATAAA
TGAAGATTACCCTCAAATGCTAGAAGCTGTCTAGGTCCGTCCGGTGTGTCAGATTTTCCTCAGATTAGATGTGCCAATAACCAAGTTTAT
TCAGTAAACAACTTGTACTTGTTTCATCTGGTTTTATTACTCTCACCCATAAACAGTAATGACTCTCTGACCCTCTGGAAATATGTAATG
CTTCCAATCTTGCTTTGTGTATCTCATTTAATTTGTTATAAGGTAGTACTGATTTTAGCATATTAATGCGATTTCTTCCTTGTTGTTTGC
TTTGGTCTGTGTTCAATCCAGAGAGCTTAAATTGTCATTATTTTGGGAAGAAAACCTGTATTTTTGTTAGTTTACAATATTATGAAATTT
CACTTCAGGAGAAACTGCTGGGCTTCCTGTGGCTTTGTTTTCTTAGTTACTTTTTCCGTGCCGTGTATTTTTTAATTGATTTTTCTTCTT
TTACTTGAAAAGAAAGTGTTTTATTTTCAAATCTGGTCCATATTTACATTCTAGTTCAGAGCCAAGCCTTAAACTGTACAGAATTTCCAC
TGTAATTAAAACTATTTAGTGTTAGTTATAAATAGCCTTCAAAAAGAGAGATTCTCCATTACACGATCACCTGCATCACAGCCCATGGTG

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_1407nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGCCTATATGGAGTTCCCTCTTCTAACCCA
ACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAAGACACTGGCAGAGAGATCTTCCCATAA
TAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAAGAGCAGCATTTTTAATTTTCACAAAAT
GTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAACACATAAACAATTCATGCCTTTCATAG

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_1500nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA
GATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGC
CTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAA
GACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAA
GAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAA

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_1108nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA

>In-frame_CLTC_ENST00000393043_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_1108nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_2209nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA
GATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGC
CTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAA
GACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAA
GAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAA
CACATAAACAATTCATGCCTTTCATAGTTTATTATTATTAAAGTCTAAACAAAATTGCAATTTCTTAGGTAACCTTATATTTACAATAAA
TGAAGATTACCCTCAAATGCTAGAAGCTGTCTAGGTCCGTCCGGTGTGTCAGATTTTCCTCAGATTAGATGTGCCAATAACCAAGTTTAT
TCAGTAAACAACTTGTACTTGTTTCATCTGGTTTTATTACTCTCACCCATAAACAGTAATGACTCTCTGACCCTCTGGAAATATGTAATG
CTTCCAATCTTGCTTTGTGTATCTCATTTAATTTGTTATAAGGTAGTACTGATTTTAGCATATTAATGCGATTTCTTCCTTGTTGTTTGC
TTTGGTCTGTGTTCAATCCAGAGAGCTTAAATTGTCATTATTTTGGGAAGAAAACCTGTATTTTTGTTAGTTTACAATATTATGAAATTT
CACTTCAGGAGAAACTGCTGGGCTTCCTGTGGCTTTGTTTTCTTAGTTACTTTTTCCGTGCCGTGTATTTTTTAATTGATTTTTCTTCTT
TTACTTGAAAAGAAAGTGTTTTATTTTCAAATCTGGTCCATATTTACATTCTAGTTCAGAGCCAAGCCTTAAACTGTACAGAATTTCCAC
TGTAATTAAAACTATTTAGTGTTAGTTATAAATAGCCTTCAAAAAGAGAGATTCTCCATTACACGATCACCTGCATCACAGCCCATGGTG

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_1407nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGCCTATATGGAGTTCCCTCTTCTAACCCA
ACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAAGACACTGGCAGAGAGATCTTCCCATAA
TAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAAGAGCAGCATTTTTAATTTTCACAAAAT
GTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAACACATAAACAATTCATGCCTTTCATAG

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_1500nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA
GATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGC
CTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAA
GACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAA
GAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAA

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_1108nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA

>In-frame_CLTC_ENST00000269122_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_1108nt
GGCGGAGTTCTGTCGCCGGGATCCTTCCGCTGGGCTCAGCCGTTTCCGGAGTCTGCGCTGCGCCCGGTTCCGCCATTGCGGCTCTCCTGG
CCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCTGCTGAGCCCAGCCTCC
CCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGACCATAACCCCCGACAG
CGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTGGAATAGAGACGGAACC
CACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGGTGCACGCGAGTGGGGA
TGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGGGCTCTGCCTTGACGGA
GGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCCGTGAGCGACAAGAGGA
GCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGGAAACCATCAGTTTTGG
CAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAACCATCACATATGAATC
ATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCACCAGTACCACCACCAC
TACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGGATGCAGACATTGACCA
TGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGGTCCATAAAGAGACAGA

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000341928_chr18_5397425_-_2135nt
ATTGCGGCTCTCCTGGCCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCT
GCTGAGCCCAGCCTCCCCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGA
CCATAACCCCCGACAGCGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTG
GAATAGAGACGGAACCCACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGG
TGCACGCGAGTGGGGATGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGG
GCTCTGCCTTGACGGAGGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCC
GTGAGCGACAAGAGGAGCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGG
AAACCATCAGTTTTGGCAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAA
CCATCACATATGAATCATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCA
CCAGTACCACCACCACTACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGG
ATGCAGACATTGACCATGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGG
TCCATAAAGAGACAGAGATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCG
TTAGGAAAACCAGAGCCTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGAC
CTTGACCATTAATAAAGACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAA
CGATAAAATTACAAAAGAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAA
CCGTGGTCTCATGTAACACATAAACAATTCATGCCTTTCATAGTTTATTATTATTAAAGTCTAAACAAAATTGCAATTTCTTAGGTAACC
TTATATTTACAATAAATGAAGATTACCCTCAAATGCTAGAAGCTGTCTAGGTCCGTCCGGTGTGTCAGATTTTCCTCAGATTAGATGTGC
CAATAACCAAGTTTATTCAGTAAACAACTTGTACTTGTTTCATCTGGTTTTATTACTCTCACCCATAAACAGTAATGACTCTCTGACCCT
CTGGAAATATGTAATGCTTCCAATCTTGCTTTGTGTATCTCATTTAATTTGTTATAAGGTAGTACTGATTTTAGCATATTAATGCGATTT
CTTCCTTGTTGTTTGCTTTGGTCTGTGTTCAATCCAGAGAGCTTAAATTGTCATTATTTTGGGAAGAAAACCTGTATTTTTGTTAGTTTA
CAATATTATGAAATTTCACTTCAGGAGAAACTGCTGGGCTTCCTGTGGCTTTGTTTTCTTAGTTACTTTTTCCGTGCCGTGTATTTTTTA
ATTGATTTTTCTTCTTTTACTTGAAAAGAAAGTGTTTTATTTTCAAATCTGGTCCATATTTACATTCTAGTTCAGAGCCAAGCCTTAAAC
TGTACAGAATTTCCACTGTAATTAAAACTATTTAGTGTTAGTTATAAATAGCCTTCAAAAAGAGAGATTCTCCATTACACGATCACCTGC

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000544123_chr18_5397425_-_1333nt
ATTGCGGCTCTCCTGGCCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCT
GCTGAGCCCAGCCTCCCCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGA
CCATAACCCCCGACAGCGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTG
GAATAGAGACGGAACCCACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGG
TGCACGCGAGTGGGGATGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGG
GCTCTGCCTTGACGGAGGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCC
GTGAGCGACAAGAGGAGCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGG
AAACCATCAGTTTTGGCAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAA
CCATCACATATGAATCATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCA
CCAGTACCACCACCACTACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGG
ATGCAGACATTGACCATGACCAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCGTTAGGAAAACCAGAGCCTATATGGAGT
TCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGACCTTGACCATTAATAAAGACACTGGCAG
AGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAACGATAAAATTACAAAAGAGCAGCATTT
TTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAACCGTGGTCTCATGTAACACATAAACAA

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000540638_chr18_5397425_-_1426nt
ATTGCGGCTCTCCTGGCCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCT
GCTGAGCCCAGCCTCCCCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGA
CCATAACCCCCGACAGCGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTG
GAATAGAGACGGAACCCACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGG
TGCACGCGAGTGGGGATGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGG
GCTCTGCCTTGACGGAGGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCC
GTGAGCGACAAGAGGAGCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGG
AAACCATCAGTTTTGGCAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAA
CCATCACATATGAATCATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCA
CCAGTACCACCACCACTACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGG
ATGCAGACATTGACCATGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGG
TCCATAAAGAGACAGAGATCACACCAGAAGATGGAGAGGATTGACCAGAGGAATAACTTAGCTTGCACATGAATGCAGTCATGCAAACCG
TTAGGAAAACCAGAGCCTATATGGAGTTCCCTCTTCTAACCCAACTGACTTGTATCTGTCCGTGGAAAATTTCAGTCCAGAAGAATTGAC
CTTGACCATTAATAAAGACACTGGCAGAGAGATCTTCCCATAATAAAGCAATCTGATTCAGCATCACTAAACCGATAATGCATGAAGCAA
CGATAAAATTACAAAAGAGCAGCATTTTTAATTTTCACAAAATGTCTCAGTTTTCAGCTATACCTGCACGTTCATAACCAACAATATAAA

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000342933_chr18_5397425_-_1034nt
ATTGCGGCTCTCCTGGCCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCT
GCTGAGCCCAGCCTCCCCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGA
CCATAACCCCCGACAGCGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTG
GAATAGAGACGGAACCCACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGG
TGCACGCGAGTGGGGATGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGG
GCTCTGCCTTGACGGAGGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCC
GTGAGCGACAAGAGGAGCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGG
AAACCATCAGTTTTGGCAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAA
CCATCACATATGAATCATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCA
CCAGTACCACCACCACTACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGG
ATGCAGACATTGACCATGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGG

>In-frame_CLTC_ENST00000579456_chr17_57697534_+_EPB41L3_ENST00000400111_chr18_5397425_-_1034nt
ATTGCGGCTCTCCTGGCCCCTGGAGCCTCCGCCCCCGACCCGAGCTCTTTCGTCTGCCTGCCAGTTTCCTGCGTCCCCGGAGAGGATCCT
GCTGAGCCCAGCCTCCCCCCTCCCCTTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGCCACTGCCCCGCAGCCCCAGTGACAGGAGGAGA
CCATAACCCCCGACAGCGCCATGGCCCAGATTCTGCCAATTCGTTTTCAGGAGCATCTCCAGAAAATGGAAACCAAGACGGAGTCCAGTG
GAATAGAGACGGAACCCACCGTGCACCACCTGCCGCTTAGCACTGAGAAGGTGGTGCAGGAGACCGTGTTGGTGGAGGAGCGGCGTGTGG
TGCACGCGAGTGGGGATGCTTCTTACTCGGCGGGAGACAGCGGGGATGCTGCAGCACAGCCCGCATTCACAGGCATTAAAGGGAAAGAGG
GCTCTGCCTTGACGGAGGGGGCTAAAGAGGAAGGAGGGGAGGAGGTCGCTAAAGCTGTCCTGGAACAGGAAGAGACAGCCGCTGCTTCCC
GTGAGCGACAAGAGGAGCAGAGTGCAGCCATCCACATTTCAGAAACTTTGGAACAAAAACCTCATTTTGAGTCCTCAACGGTGAAGACGG
AAACCATCAGTTTTGGCAGTGTTTCACCGGGAGGAGTAAAGCTAGAAATTTCCACGAAGGAAGTGCCAGTAGTTCACACCGAAACCAAAA
CCATCACATATGAATCATCACAGGTCGATCCAGGCACAGATCTGGAGCCAGGCGTGCTGATGAGTGCACAGACGATCACATCTGAAACCA
CCAGTACCACCACCACTACGCACATCACCAAAACTGTGAAAGGGGGCATTTCAGAGACAAGAATTGAGAAGCGAATAGTCATCACGGGGG
ATGCAGACATTGACCATGACCAGGCGCTGGCTCAGGCAATTAAAGAGGCCAAAGAGCAGCACCCTGACATGTCAGTGACCAAAGTAGTGG


Top

FusionGenePPI for CLTC_EPB41L3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLTCHGS, MCC, IKBKE, TFE3, SNX5, TOM1, SNX9, DNAJC6, ARMCX3, C10orf88, EPN1, EHD1, GGA1, GGA2, GGA3, KIT, AMPH, CLINT1, TNK2, LDLRAP1, HIP1, AP1B1, AP2A2, AP3B2, MAP3K10, PICALM, EPN2, VCL, STAMBP, STAMBPL1, STAM, MAP1LC3A, SNCA, PRKACA, WNK1, HDAC5, SPG20, RICTOR, PCM1, NDRG1, PPP1CA, ITSN1, ARRB1, SIRT7, SH3KBP1, DYRK1A, SNAP91, AP2B1, BIN1, AP1G1, RAC1, TOM1L1, TOM1L2, ISG15, CUL3, CUL5, CUL2, CDK2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, XRCC6, HERC1, ATG16L1, SYNJ1, LRRK2, AKT1, GRB2, SHC1, AP2M1, MYO6, SRC, FYN, DNAJA3, RPSA, ESR1, PAXIP1, PPP1CC, SMURF1, ARRB2, ERBB2, FN1, VCAM1, DAB2, UBL4A, ITGA4, MYBL2, SVIL, PAN2, NPM1, PTAFR, ATP4A, EP300, QARS, YWHAQ, FBXO6, RPA1, RPA2, RPA3, ERG, EPHA2, LGR4, STAU1, TP53, HUWE1, FBXW11, GJB5, NXF1, ADRB2, AVPR2, CUL7, OBSL1, CCDC8, EED, ZFYVE9, OCRL, ATR, SCYL2, HTR6, HNRNPA1, UNK, ATP1A1, ATP1A2, ATP1A3, ATP5C1, CCDC47, CCT3, CCT6A, BLOC1S1, CAD, CANX, CCT6B, CISD1, CLTA, CYC1, DHX38, EHD2, FASTKD2, HSP90B1, IPO5, MTCH2, NDUFB9, NDUFS1, NLRP1, RAB5B, RANBP2, RANBP6, SLC25A3, SSR3, TECR, TOMM22, UQCRC2, VDAC1, VDAC2, VDAC3, ZMPSTE24, DDOST, EIF6, COX2, PHB, PHB2, PPP2R1A, PPP2R1B, RPN1, TMCO1, TUFM, UQCRQ, NTRK1, OFD1, CEP97, CNTRL, FBF1, NPHP1, DCTN1, POC5, POC1B, PPME1, ABCA2, PARP4, AP2A1, ATP6V1B2, ATP6V0A1, CAV1, CLTB, CAPZA2, DBN1, FLNA, GAK, MYH9, DNAJC7, IQGAP1, PDLIM7, SEC16A, SYNPO, MAPRE1, LIMA1, GTSE1, ANLN, MYO19, ARX, MYO18A, CSNK1A1, CSNK1E, STOM, EPS15, HSPA1A, HSPA4, NDUFA9, CHMP1A, PIK3C2A, PRKAR2A, SEC13, SOAT1, CLTCL1, SORBS2, PKP4, USO1, NUMB, TNK1, RAB11A, HIP1R, ATP6V0D1, XPR1, SEC24C, KIAA0430, IST1, HELZ, MVP, TROAP, SEC24B, RBM14, SEC23A, VTI1B, TRAFD1, PKP3, AAK1, BTBD3, TNRC6B, EDC4, DSTYK, PTPN23, NECAP1, TNRC6A, EHD4, EGFL7, ATP6V1D, PTRH2, PLEKHA5, CPVL, BMP2K, DCP1A, ERBB2IP, CHMP1B, KIDINS220, MTUS1, DENND1A, CRTC3, CPSF7, EDC3, CCDC115, FAM83A, REPS1, STON2, FCHO2, CHMP4B, MITD1, CRTC2, FAM83B, FAM83H, SLC35B2, IKBKB, MAP3K7, MCM2, AP3D1, U2AF2, CDC73, ZNF746, ARF6, CYLD, LASP1, BRCA1, TES, MTF1, BRD1EPB41L3MBIP, SMYD2, YWHAG, YWHAB, YWHAZ, YWHAQ, SPTBN1, CNTNAP2, CADM1, YWHAH, CEP152, UNC13A, ELAVL1, ARRB2, SIRT7, ATXN1L, PSEN1, PAXIP1, MAGOH, EIF4A3, SMURF1, FBXO6, ASB3, GSK3B, HUWE1, TCF4, ABCE1, DDAH2, YWHAE, ACIN1, MLLT3, PRMT5, AP3B1, AP3D1, AP3M1, AP3S1, ATAD3A, CSNK2A1, CSNK2A2, CSNK2B, CWC22, CWC27, DDB1, DHX15, DKC1, DPY30, DYNLL1, EPB41L1, EPB41L2, EIF2B2, EIF2B4, ENY2, GID8, GPATCH8, HSPA12A, CLNS1A, KANK1, LYAR, WDR77, C1orf35, NAF1, NUMA1, PLA2G12A, PIP4K2A, PIP4K2B, PIP4K2C, PNN, PRPF4B, RANBP9, RBFA, RNPS1, RPS15, SNRPB, SAP18, SCML1, SCOC, SETD1A, SRRM1, SRRM2, TAF2, VANGL1, VPRBP, WDR26, ZC3H18, ZRANB2, WWC1, HSPB1, MED4, KIF1C, ELMSAN1, KIF7, CDC5L, FAF2, DERL1, CDH1, MISP, PRICKLE3, SNRPN, CACNG5, CYP2S1, SPTA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLTC_EPB41L3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CLTC_EPB41L3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCLTCC0079744Diffuse Large B-Cell Lymphoma1CTD_human
TgeneEPB41L3C1458155Mammary Neoplasms1CTD_human