FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7424

FusionGeneSummary for CLK2_CD244

check button Fusion gene summary
Fusion gene informationFusion gene name: CLK2_CD244
Fusion gene ID: 7424
HgeneTgene
Gene symbol

CLK2

CD244

Gene ID

9894

51744

Gene nametelomere maintenance 2CD244 molecule
SynonymsCLK2|TEL2|YHFS2B4|NAIL|NKR2B4|Nmrk|SLAMF4
Cytomap

16p13.3

1q23.3

Type of geneprotein-codingprotein-coding
Descriptiontelomere length regulation protein TEL2 homologTEL2, telomere maintenance 2, homologprotein clk-2 homolognatural killer cell receptor 2B4CD244 molecule, natural killer cell receptor 2B4NK cell activation inducing ligand NAILNK cell activation-inducing ligandNK cell type I receptor protein 2B4SLAM family member 4h2B4signaling lymphocytic activation mol
Modification date2018052320180519
UniProtAcc

P49760

Q9BZW8

Ensembl transtripts involved in fusion geneENST00000361168, ENST00000368361, 
ENST00000355560, ENST00000497188, 
ENST00000536801, 
ENST00000368034, 
ENST00000368033, ENST00000322302, 
ENST00000368032, ENST00000481677, 
Fusion gene scores* DoF score5 X 5 X 5=1253 X 2 X 3=18
# samples 53
** MAII scorelog2(5/125*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CLK2 [Title/Abstract] AND CD244 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationDDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCD244

GO:0002323

natural killer cell activation involved in immune response

11714776

TgeneCD244

GO:0060732

positive regulation of inositol phosphate biosynthetic process

8376943

TgeneCD244

GO:0071663

positive regulation of granzyme B production

11714776

TgeneCD244

GO:1902715

positive regulation of interferon-gamma secretion

11714776

TgeneCD244

GO:2000484

positive regulation of interleukin-8 secretion

8376943


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AC-A62V-01ACLK2chr1

155239279

-CD244chr1

160808839

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000361168ENST00000368034CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000361168ENST00000368033CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000361168ENST00000322302CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000361168ENST00000368032CLK2chr1

155239279

-CD244chr1

160808839

-
5CDS-5UTRENST00000361168ENST00000481677CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000368361ENST00000368034CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000368361ENST00000368033CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000368361ENST00000322302CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000368361ENST00000368032CLK2chr1

155239279

-CD244chr1

160808839

-
5CDS-5UTRENST00000368361ENST00000481677CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000355560ENST00000368034CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000355560ENST00000368033CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000355560ENST00000322302CLK2chr1

155239279

-CD244chr1

160808839

-
Frame-shitENST00000355560ENST00000368032CLK2chr1

155239279

-CD244chr1

160808839

-
5CDS-5UTRENST00000355560ENST00000481677CLK2chr1

155239279

-CD244chr1

160808839

-
intron-3CDSENST00000497188ENST00000368034CLK2chr1

155239279

-CD244chr1

160808839

-
intron-3CDSENST00000497188ENST00000368033CLK2chr1

155239279

-CD244chr1

160808839

-
intron-3CDSENST00000497188ENST00000322302CLK2chr1

155239279

-CD244chr1

160808839

-
intron-3CDSENST00000497188ENST00000368032CLK2chr1

155239279

-CD244chr1

160808839

-
intron-5UTRENST00000497188ENST00000481677CLK2chr1

155239279

-CD244chr1

160808839

-
In-frameENST00000536801ENST00000368034CLK2chr1

155239279

-CD244chr1

160808839

-
In-frameENST00000536801ENST00000368033CLK2chr1

155239279

-CD244chr1

160808839

-
In-frameENST00000536801ENST00000322302CLK2chr1

155239279

-CD244chr1

160808839

-
In-frameENST00000536801ENST00000368032CLK2chr1

155239279

-CD244chr1

160808839

-
5CDS-5UTRENST00000536801ENST00000481677CLK2chr1

155239279

-CD244chr1

160808839

-

Top

FusionProtFeatures for CLK2_CD244


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLK2

P49760

CD244

Q9BZW8

Dual specificity kinase acting on both serine/threonineand tyrosine-containing substrates. Phosphorylates serine- andarginine-rich (SR) proteins of the spliceosomal complex. May be aconstituent of a network of regulatory mechanisms that enable SRproteins to control RNA splicing and can cause redistribution ofSR proteins from speckles to a diffuse nucleoplasmic distribution.Acts as a suppressor of hepatic gluconeogenesis and glucose outputby repressing PPARGC1A transcriptional activity on gluconeogenicgenes via its phosphorylation. Phosphorylates PPP2R5B therebystimulating the assembly of PP2A phosphatase with the PPP2R5B-AKT1complex leading to dephosphorylation of AKT1. Phosphorylates:PTPN1, SRSF1 and SRSF3. Regulates the alternative splicing oftissue factor (F3) pre-mRNA in endothelial cells.{ECO:0000269|PubMed:10480872, ECO:0000269|PubMed:19168442,ECO:0000269|PubMed:8910305, ECO:0000269|PubMed:9637771}. Heterophilic receptor of the signaling lymphocyticactivation molecule (SLAM) family; its ligand is CD48. SLAMreceptors triggered by homo- or heterotypic cell-cell interactionsare modulating the activation and differentiation of a widevariety of immune cells and thus are involved in the regulationand interconnection of both innate and adaptive immune response.Activities are controlled by presence or absence of smallcytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Actsas activating natural killer (NK) cell receptor (PubMed:10359122,PubMed:8376943, PubMed:11714776). Activating function implicatesassociation with SH2D1A and FYN (PubMed:15713798). Downstreamingsignaling involves predominantly VAV1, and, to a lesser degree,INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1Ais proposed to be dependent on INPP5D and to a lesser extentPTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10934222, PubMed:15713798).Stimulates NK cell cytotoxicity, production of IFN-gamma andgranule exocytosis (PubMed:8376943, PubMed:11714776). Optimalexpansion and activation of NK cells seems to be dependent on theengagement of CD244 with CD48 expressed on neighboring NK cells(By similarity). Acts as costimulator in NK activation byenhancing signals by other NK receptors such as NCR3 and NCR1(PubMed:10741393). At early stages of NK cell differentiation mayfunction as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells (PubMed:11917118). Involved inthe regulation of CD8(+) T-cell proliferation; expression onactivated T-cells and binding to CD488 provides costimulatory-likefunction for neighboring T-cells (By similarity). Inhibitsinflammatory responses in dendritic cells (DCs) (By similarity).{ECO:0000250|UniProtKB:Q07763, ECO:0000269|PubMed:10359122,ECO:0000269|PubMed:10741393, ECO:0000269|PubMed:10934222,ECO:0000269|PubMed:11714776, ECO:0000269|PubMed:11917118,ECO:0000269|PubMed:8376943, ECO:0000305|PubMed:15713798}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CLK2_CD244


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368034_chr1_160808839_-_280aa
MPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDRSSDRRVTDRRYCGSYRRNDTSRDRGDAY
TDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSNSDFGRFW_SS_F_AHCSLAPLPASVCGGERGRRSSQRPVPRNF_QF
TKMSRI_KPGEITSRSRLFLEGGAPSTL_SSPSLLLPRHKNLHIHTIH_FSLPGSLDPGRGTTALPSIALSMK_LERVNLKPRTLLD_AA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368033_chr1_160808839_-_280aa
MPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDRSSDRRVTDRRYCGSYRRNDTSRDRGDAY
TDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSNSDFGRFW_SS_F_AHCSLAPLPASVCGGERGRRSSQRPVPRNF_QF
TKMSRI_KPGEITSRSRLFLEGGAPSTL_SSPSLLLPRHKNLHIHTIH_FSLPGSLDPGRGTTALPSIALSMK_LERVNLKPRTLLD_AA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000322302_chr1_160808839_-_280aa
MPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDRSSDRRVTDRRYCGSYRRNDTSRDRGDAY
TDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSNSDFGRFW_SS_F_AHCSLAPLPASVCGGERGRRSSQRPVPRNF_QF
TKMSRI_KPGEITSRSRLFLEGGAPSTL_SSPSLLLPRHKNLHIHTIH_FSLPGSLDPGRGTTALPSIALSMK_LERVNLKPRTLLD_AA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368032_chr1_160808839_-_244aa
MPHPRRYHSSERGSRGSYREHTRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSTDDRSSDRRVTDRRYCGSYRRNDTSRDRGDAY
TDTDTRHSTETQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSNSDFGRFW_SS_F_AHCSLAPLPASVCGGERGRRSSQRPVPRNF_QF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368034_chr1_160808839_-_842nt
ATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGA
AGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGAT
GATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTAC
TATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGG
CGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGT
TCCTTGGCACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTT
ACGAAGATGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCC
AGTCCCAGTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGA
GGAACCACAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368033_chr1_160808839_-_842nt
ATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGA
AGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGAT
GATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTAC
TATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGG
CGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGT
TCCTTGGCACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTT
ACGAAGATGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCC
AGTCCCAGTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGA
GGAACCACAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000322302_chr1_160808839_-_842nt
ATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGA
AGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGAT
GATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTAC
TATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGG
CGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGT
TCCTTGGCACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTT
ACGAAGATGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCC
AGTCCCAGTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGA
GGAACCACAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368032_chr1_160808839_-_734nt
ATGCCGCATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGA
AGAAGTCGCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGAT
GATCGTTCGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTAC
TATGACACAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGG
CGGAGGAGGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGT
TCCTTGGCACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTT
ACGAAGATGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCC
AGTCCCAGTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGGGTGACAGATTCTATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368034_chr1_160808839_-_2202nt
AGATTTGGGGATCGGACCTGAGGCCGCGGTCGCAGGCGGGGGAGCAACGGGAGGCACCGCCTCCAGTCCAGGGGTCGCCCCTTCGCTGGC
CCCCGCCGCCGGCCGCTGCTCTGCCTCCATGGCGCCCACCCCGCTTACACGCTCGGCCTCCTAGAGCCCTCTGTGGCCATCAGATGCCGC
ATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTC
GCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTT
CGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACA
CAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGA
GGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGTTCCTTGG
CACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTTACGAAGA
TGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCCAGTCCCA
GTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGAGGAACCA
CAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCAAAGAGCT
GGAGAACTTTGATGTTTATTCCTAGTTGCTGCAGCAATTCTCACCTTTCTTGCACATCAGCATCTGCTTTGGGAATTGGCACAGTGGATG
ACGGCACAGGAGTCTCTATAGAACAGTTCCTAGTCTGGAGAGGATATGGAAATTTGTTCTTGTTCTATATTTTGTTTTGAAAATGATGTC
TAACAACCATGATAAGAGCAAGGCTGTTAAATAATATCTTCCAATTTACAGATCAGACATGAATGGGTGGAGGGGTTAGGTTGTTCACAA
AAGGCCACATTCCAAGTATTTGTAATCTAGAAAGTGTTATGTAAGTGATGTTATTAGCATCGAGATTCCCTCCACCTGATTTTCAAGCTG
TCACTTGTTTCCTTTTCTCCCCTCTCTGGGTTGACTGCATTTCTAGACTCTCGCCGGCCCAGGCCCATCTTCCAAAGCAAGAGGAAGGAA
TGATAATGGTGACTCAGGGGAAGAAGAAACAGCCCTCCTCTGAAAGCCTGGACTGTCCGGCTGTGAACTGGCTGGCAGGTTCTGCACGTG
GGTGGGGGCCAGGGCCTGGGCTTTACTCAATTGCAGAGAAAAAACTTTCTCCCTGCATCTCATACCTTTACCTCTGGCCAGTTGGCCACC
AGGGGGAGTGGGCTGAAGGGAGAGTAGATGGTGCAAAGCAAGCCCATCTCTAAGTAGAAAAATCACCCAGAGCACATGCTGACCTGATAA
CTGGGGTGTTGAGACCAGCTTTGTCCATGGTATGATGTTTGATTTATGAAGACGCATTGTTAGAAATCCATTTGGCTTCTTCATAGAAGT
GGCTTCCCAGAGGAAGAGGCCTCTCAGAAACCATGTTCTATTTAAGTTCTGAGTCCTGATGAGTGTTCCCCAGGATGCACATTGAAGGGA
GGGCTCAGGCAGCTGAGGGCTGAGAATGAGGCAGTTGGAATCTAGACACTATGCTGGGTTCCCTGAGTCGTCAGGCCAGACATTTCAACA
AGGCTGTGGGGAGCAGGGCTGTGACTCTGGCTGAGCCCAGGAAAGCGACAAGGGTGAACTGGGAGAGGACTTACTCAGAGACCCCAACAG
GTGATACTGCACAAAGCCTGGTTCTTCAATTTTCCTACCCTGTATCTAACATAGGAGTTTCATATAAAACGGTGATATCATGCAGATGCA

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368033_chr1_160808839_-_1179nt
AGATTTGGGGATCGGACCTGAGGCCGCGGTCGCAGGCGGGGGAGCAACGGGAGGCACCGCCTCCAGTCCAGGGGTCGCCCCTTCGCTGGC
CCCCGCCGCCGGCCGCTGCTCTGCCTCCATGGCGCCCACCCCGCTTACACGCTCGGCCTCCTAGAGCCCTCTGTGGCCATCAGATGCCGC
ATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTC
GCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTT
CGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACA
CAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGA
GGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGTTCCTTGG
CACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTTACGAAGA
TGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCCAGTCCCA
GTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGAGGAACCA
CAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCAAAGAGCT
GGAGAACTTTGATGTTTATTCCTAGTTGCTGCAGCAATTCTCACCTTTCTTGCACATCAGCATCTGCTTTGGGAATTGGCACAGTGGATG
ACGGCACAGGAGTCTCTATAGAACAGTTCCTAGTCTGGAGAGGATATGGAAATTTGTTCTTGTTCTATATTTTGTTTTGAAAATGATGTC

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000322302_chr1_160808839_-_1091nt
AGATTTGGGGATCGGACCTGAGGCCGCGGTCGCAGGCGGGGGAGCAACGGGAGGCACCGCCTCCAGTCCAGGGGTCGCCCCTTCGCTGGC
CCCCGCCGCCGGCCGCTGCTCTGCCTCCATGGCGCCCACCCCGCTTACACGCTCGGCCTCCTAGAGCCCTCTGTGGCCATCAGATGCCGC
ATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTC
GCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTT
CGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACA
CAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGA
GGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGTTCCTTGG
CACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTTACGAAGA
TGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCCAGTCCCA
GTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGAGGAACCA
CAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAACCCTGCTCGATTGAGCCGCAAAGAGCT
GGAGAACTTTGATGTTTATTCCTAGTTGCTGCAGCAATTCTCACCTTTCTTGCACATCAGCATCTGCTTTGGGAATTGGCACAGTGGATG

>In-frame_CLK2_ENST00000536801_chr1_155239279_-_CD244_ENST00000368032_chr1_160808839_-_907nt
AGATTTGGGGATCGGACCTGAGGCCGCGGTCGCAGGCGGGGGAGCAACGGGAGGCACCGCCTCCAGTCCAGGGGTCGCCCCTTCGCTGGC
CCCCGCCGCCGGCCGCTGCTCTGCCTCCATGGCGCCCACCCCGCTTACACGCTCGGCCTCCTAGAGCCCTCTGTGGCCATCAGATGCCGC
ATCCTCGAAGGTACCACTCCTCAGAGCGAGGCAGCCGGGGGAGTTACCGTGAACACTATCGGAGCCGAAAGCATAAGCGACGAAGAAGTC
GCTCCTGGTCAAGTAGTAGTGACCGGACACGACGGCGTCGGCGAGAGGACAGCTACCATGTCCGTTCTCGAAGCAGTTATGATGATCGTT
CGTCCGACCGGAGGGTGTATGACCGGCGATACTGTGGCAGCTACAGACGCAACGATTATAGCCGGGATCGGGGAGATGCCTACTATGACA
CAGACTATCGGCATTCCTATGAATATCAGCGGGAGAACAGCAGTTACCGCAGCCAGCGCAGCAGCCGGAGGAAGCACAGACGGCGGAGGA
GGCGCAGCCGGACATTTAGCCGCTCATCTTCGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTAAGCGCACTGTTCCTTGG
CACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAGAGACCAGTCCCAAGGAATTTTTGACAATTTACGAAGA
TGTCAAGGATCTGAAAACCAGGAGAAATCACGAGCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCCAGTCCCA
GTCTTCTGCTCCCACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGGGTGACAGATTCTATTCATTTTC


Top

FusionGenePPI for CLK2_CD244


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLK2CLK3, UBL5, FANCM, C19orf40, YWHAG, HSP90AA1, AKT1, SNRNP70, PNN, HNRNPM, LUC7L, TNPO3, CLK2, HUWE1, PSME3, SKIV2L2, ZCCHC8, BCLAF1, CPSF1, FIP1L1, RBBP6, WDR33, PPHLN1, RBM7, ACIN1, PABPC1, SETD2, PKP2, THRAP3, CPSF2, RBM39, SON, ZNF30, HNRNPF, CPSF4, CDKN2A, ECE1, TRIM27, SDCBP, SRPK2, U2AF1, UBE2I, ZRSR2, ZNF263, SRRM1, RNPS1, KLHL2, ZNF473, MRPL4, LUZP4, RSRP1, ZNF398, GMCL1, SNIP1, CPSF7, ZNF394, LNX1, PRPF38A, YTHDC1, BRCA1, EED, TRA2A, LUC7L2, TBC1D9B, NKTR, ZC3H18, CLK1, RBMXL1, SRSF8, ELAVL2, CLASRP, GPATCH8, ZNF638, C11orf57, SRSF12, MDK, SRSF10, NCOA5, EPB41L2, RSBN1L, C17orf85, GPALPP1, APOBEC3D, U2AF2, CDX1, ZC3H14, GSPT2, REPIN1, SRRT, JPH4, CASC3, PRPF4B, PTPN1CD244SH2D1A, FYN, IMMT, CAND2, HEATR1, HEATR6, PDXDC1, PI4KA, ARFGEF1, ARFGEF2, MTOR, POMT2, POMT1, PIK3R1, UFSP2, LTN1, RNF213, MTX2, MTX3, ST7, MYADM, C9orf89, BZRAP1, CHCHD6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLK2_CD244


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CLK2_CD244


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCD244C0003873Rheumatoid Arthritis1CTD_human