FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7329

FusionGeneSummary for CLCN6_RAF1

check button Fusion gene summary
Fusion gene informationFusion gene name: CLCN6_RAF1
Fusion gene ID: 7329
HgeneTgene
Gene symbol

CLCN6

RAF1

Gene ID

1185

5894

Gene namechloride voltage-gated channel 6Raf-1 proto-oncogene, serine/threonine kinase
SynonymsCLC-6CMD1NN|CRAF|NS5|Raf-1|c-Raf
Cytomap

1p36.22

3p25.2

Type of geneprotein-codingprotein-coding
Descriptionchloride transport protein 6chloride channel, voltage-sensitive 6RAF proto-oncogene serine/threonine-protein kinaseC-Raf proto-oncogene, serine/threonine kinaseOncogene RAF1proto-oncogene c-RAFraf proto-oncogene serine/threonine protein kinasev-raf-1 murine leukemia viral oncogene homolog 1v-raf-1 murine leukemia
Modification date2018052320180523
UniProtAcc

P51797

P04049

Ensembl transtripts involved in fusion geneENST00000312413, ENST00000346436, 
ENST00000376497, ENST00000376487, 
ENST00000376496, ENST00000376492, 
ENST00000251849, ENST00000442415, 
ENST00000534997, ENST00000542177, 
Fusion gene scores* DoF score2 X 2 X 2=89 X 4 X 6=216
# samples 212
** MAII scorelog2(2/8*10)=1.32192809488736log2(12/216*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CLCN6 [Title/Abstract] AND RAF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRAF1

GO:0000186

activation of MAPKK activity

10644344

TgeneRAF1

GO:0007190

activation of adenylate cyclase activity

15385642

TgeneRAF1

GO:0008285

negative regulation of cell proliferation

9765203

TgeneRAF1

GO:0031333

negative regulation of protein complex assembly

19667065

TgeneRAF1

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneRAF1

GO:0043066

negative regulation of apoptotic process

19667065


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A19L-06ACLCN6chr1

11867247

+RAF1chr3

12641914

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000312413ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000312413ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000312413ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000312413ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000346436ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000346436ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000346436ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000346436ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376497ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376497ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376497ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376497ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376487ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376487ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376487ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376487ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376496ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376496ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376496ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
In-frameENST00000376496ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-
3UTR-3CDSENST00000376492ENST00000251849CLCN6chr1

11867247

+RAF1chr3

12641914

-
3UTR-3CDSENST00000376492ENST00000442415CLCN6chr1

11867247

+RAF1chr3

12641914

-
3UTR-3CDSENST00000376492ENST00000534997CLCN6chr1

11867247

+RAF1chr3

12641914

-
3UTR-3CDSENST00000376492ENST00000542177CLCN6chr1

11867247

+RAF1chr3

12641914

-

Top

FusionProtFeatures for CLCN6_RAF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLCN6

P51797

RAF1

P04049

Serine/threonine-protein kinase that acts as aregulatory link between the membrane-associated Ras GTPases andthe MAPK/ERK cascade, and this critical regulatory link functionsas a switch determining cell fate decisions includingproliferation, differentiation, apoptosis, survival and oncogenictransformation. RAF1 activation initiates a mitogen-activatedprotein kinase (MAPK) cascade that comprises a sequentialphosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 andMAP2K2/MEK2) and the extracellular signal-regulated kinases(MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (onresidues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at 'Ser-75'. Phosphorylates adenylylcyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation.Phosphorylates PPP1R12A resulting in inhibition of the phosphataseactivity. Phosphorylates TNNT2/cardiac muscle troponin T. Canpromote NF-kB activation and inhibit signal transducers involvedin motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2),proliferation and angiogenesis (RB1). Can protect cells fromapoptosis also by translocating to the mitochondria where it bindsBCL2 and displaces BAD/Bcl2-antagonist of cell death. RegulatesRho signaling and migration, and is required for normal woundhealing. Plays a role in the oncogenic transformation ofepithelial cells via repression of the TJ protein, occludin (OCLN)by inducing the up-regulation of a transcriptional repressorSNAI2/SLUG, which induces down-regulation of OCLN. Restrictscaspase activation in response to selected stimuli, notably Fasstimulation, pathogen-mediated macrophage apoptosis, and erythroiddifferentiation. {ECO:0000269|PubMed:11427728,ECO:0000269|PubMed:11719507, ECO:0000269|PubMed:15385642,ECO:0000269|PubMed:15618521, ECO:0000269|PubMed:15849194,ECO:0000269|PubMed:16892053, ECO:0000269|PubMed:16924233,ECO:0000269|PubMed:9360956}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+2224_18491464Compositional biasNote=Cys-rich
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+2234_1849870Compositional biasNote=Cys-rich
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+2224_1849848Compositional biasNote=Cys-rich
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+2224_1849954Compositional biasNote=Cys-rich
TgeneRAF1chr1:11867247chr3:12641914ENST00000251849-617349_609278649DomainProtein kinase
TgeneRAF1chr1:11867247chr3:12641914ENST00000442415-718349_609298669DomainProtein kinase
TgeneRAF1chr1:11867247chr3:12641914ENST00000251849-617355_363278649Nucleotide bindingATP
TgeneRAF1chr1:11867247chr3:12641914ENST00000442415-718355_363298669Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222605_662491464DomainCBS 1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222807_868491464DomainCBS 2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223605_66249870DomainCBS 1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223807_86849870DomainCBS 2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222605_66249848DomainCBS 1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222807_86849848DomainCBS 2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222605_66249954DomainCBS 1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222807_86849954DomainCBS 2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222159_166491464IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222241_253491464IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222257_265491464IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222519_533491464IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222534_536491464IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222537_548491464IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222549_552491464IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223159_16649870IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223241_25349870IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223257_26549870IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223519_53349870IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223534_53649870IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223537_54849870IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223549_55249870IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222159_16649848IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222241_25349848IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222257_26549848IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222519_53349848IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222534_53649848IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222537_54849848IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222549_55249848IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222159_16649954IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222241_25349954IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222257_26549954IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222519_53349954IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222534_53649954IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222537_54849954IntramembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222549_55249954IntramembraneNote%3DLoop between two helices
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222156_160491464MotifSelectivity filter part_1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222198_202491464MotifSelectivity filter part_2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222487_491491464MotifSelectivity filter part_3
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223156_16049870MotifSelectivity filter part_1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223198_20249870MotifSelectivity filter part_2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223487_49149870MotifSelectivity filter part_3
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222156_16049848MotifSelectivity filter part_1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222198_20249848MotifSelectivity filter part_2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222487_49149848MotifSelectivity filter part_3
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222156_16049954MotifSelectivity filter part_1
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222198_20249954MotifSelectivity filter part_2
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222487_49149954MotifSelectivity filter part_3
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222630_632491464Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222849_852491464Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223630_63249870Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223849_85249870Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222630_63249848Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222849_85249848Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222630_63249954Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222849_85249954Nucleotide bindingATP
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+2221_80491464Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222572_869491464Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+2231_8049870Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223572_86949870Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+2221_8049848Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222572_86949848Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+2221_8049954Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222572_86949954Topological domainCytoplasmic
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222128_150491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222176_194491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222200_217491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222277_294491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222335_364491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222371_392491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222462_481491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222487_511491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+222553_571491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000312413+22281_113491464TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223128_15049870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223176_19449870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223200_21749870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223277_29449870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223335_36449870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223371_39249870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223462_48149870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223487_51149870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+223553_57149870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000346436+22381_11349870TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222128_15049848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222176_19449848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222200_21749848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222277_29449848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222335_36449848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222371_39249848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222462_48149848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222487_51149848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+222553_57149848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376487+22281_11349848TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222128_15049954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222176_19449954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222200_21749954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222277_29449954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222335_36449954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222371_39249954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222462_48149954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222487_51149954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+222553_57149954TransmembraneHelical
HgeneCLCN6chr1:11867247chr3:12641914ENST00000376496+22281_11349954TransmembraneHelical
TgeneRAF1chr1:11867247chr3:12641914ENST00000251849-61756_131278649DomainRBD
TgeneRAF1chr1:11867247chr3:12641914ENST00000442415-71856_131298669DomainRBD
TgeneRAF1chr1:11867247chr3:12641914ENST00000251849-617138_184278649Zinc fingerPhorbol-ester/DAG-type
TgeneRAF1chr1:11867247chr3:12641914ENST00000442415-718138_184298669Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for CLCN6_RAF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_420aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERA
PVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGS
QQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1260nt
ATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACC
ATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCA
CCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCA
CCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTG
ATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTT
GTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATG
GGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAG
TTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATG
AAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCT
CAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCG
GATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTC
ATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTG
AAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGC
GCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_2286nt
AGTCCCAGAGCTCGAGAGGGCCACGTGACCGTCCCGGGGCCAGTCACGTGAGGCGCAGATCCTGGCTGGGAGGGGGTTGGTAGAGGGGTC
CAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGA
CCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTC
GAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCG
TGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATT
GGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATG
TTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGC
ATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAAC
ACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAA
AGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAG
TAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATA
ACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCA
ACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGA
AGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACT
CTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGT
CCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCT
CCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCC
TTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGG
CCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGA
GGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGG
ACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGA
GCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAG
GCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGG
GGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCATGTGTATACAAGGAAG
CCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTGATGGTCCCTCAATTA

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_2089nt
AGTCCCAGAGCTCGAGAGGGCCACGTGACCGTCCCGGGGCCAGTCACGTGAGGCGCAGATCCTGGCTGGGAGGGGGTTGGTAGAGGGGTC
CAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGA
CCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTC
GAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCG
TGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATT
GGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATG
TTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGC
ATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAAC
ACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAA
AGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAG
TAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATA
ACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCA
ACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGA
AGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACT
CTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGT
CCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCT
CCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCC
TTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGG
CCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGA
GGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGG
ACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGA
GCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAG
GCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGG

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1620nt
AGTCCCAGAGCTCGAGAGGGCCACGTGACCGTCCCGGGGCCAGTCACGTGAGGCGCAGATCCTGGCTGGGAGGGGGTTGGTAGAGGGGTC
CAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGA
CCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTC
GAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCG
TGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATT
GGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATG
TTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGC
ATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAAC
ACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAA
AGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAG
TAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATA
ACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCA
ACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGA
AGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACT
CTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGT
CCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCT
CCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCC
TTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGG

>In-frame_CLCN6_ENST00000312413_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1554nt
AGTCCCAGAGCTCGAGAGGGCCACGTGACCGTCCCGGGGCCAGTCACGTGAGGCGCAGATCCTGGCTGGGAGGGGGTTGGTAGAGGGGTC
CAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGA
CCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTC
GAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCG
TGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATT
GGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATG
TTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGC
ATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAAC
ACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAA
AGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAG
TAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATA
ACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCA
ACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGA
AGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACT
CTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGT
CCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCT
CCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCC

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_2225nt
CTGGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAG
GTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCT
TCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCC
AACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCC
TCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAAC
TGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAA
TGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCA
GTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGAC
GGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGT
GAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGAT
GGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGAT
GACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAA
GCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGAT
CCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGA
GGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAG
GAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGAC
TGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTG
CTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGC
CCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAG
CTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAG
GACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAG
GTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGA
ATTTTGTCTTCCAGGAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTC
TCTAGTCACATCATGTGTATACAAGGAAGCCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAA

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_2028nt
CTGGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAG
GTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCT
TCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCC
AACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCC
TCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAAC
TGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAA
TGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCA
GTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGAC
GGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGT
GAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGAT
GGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGAT
GACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAA
GCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGAT
CCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGA
GGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAG
GAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGAC
TGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTG
CTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGC
CCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAG
CTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAG
GACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAG
GTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGA

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1559nt
CTGGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAG
GTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCT
TCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCC
AACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCC
TCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAAC
TGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAA
TGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCA
GTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGAC
GGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGT
GAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGAT
GGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGAT
GACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAA
GCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGAT
CCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGA
GGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAG
GAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGAC
TGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTG

>In-frame_CLCN6_ENST00000346436_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1493nt
CTGGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAG
GTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCT
TCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCC
AACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCC
TCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAAC
TGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAA
TGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCA
GTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGAC
GGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGT
GAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGAT
GGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGAT
GACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAA
GCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGAT
CCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGA
GGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAG
GAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGAC

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_2223nt
GGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGT
GGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTC
CAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAA
CAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTC
GTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTG
TTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATG
AGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGT
GGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGG
CTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGA
AAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGG
CCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGA
CGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGC
TATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCC
TGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGG
ATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGA
GAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTG
CTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCT
CCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCC
CAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCT
TCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGA
CTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGT
GTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAAT
TTTGTCTTCCAGGAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTC
TAGTCACATCATGTGTATACAAGGAAGCCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAA

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_2026nt
GGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGT
GGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTC
CAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAA
CAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTC
GTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTG
TTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATG
AGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGT
GGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGG
CTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGA
AAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGG
CCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGA
CGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGC
TATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCC
TGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGG
ATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGA
GAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTG
CTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCT
CCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCC
CAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCT
TCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGA
CTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGT
GTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAAT

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1557nt
GGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGT
GGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTC
CAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAA
CAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTC
GTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTG
TTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATG
AGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGT
GGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGG
CTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGA
AAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGG
CCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGA
CGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGC
TATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCC
TGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGG
ATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGA
GAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTG
CTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCT

>In-frame_CLCN6_ENST00000376497_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1491nt
GGCTGGGAGGGGGTTGGTAGAGGGGTCCAGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGT
GGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTC
CAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAA
CAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTC
GTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTG
TTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATG
AGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGT
GGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGG
CTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGA
AAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGG
CCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGA
CGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGC
TATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCC
TGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGG
ATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGA
GAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_2195nt
AGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGAC
CCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCG
AAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGT
GCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTG
GGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGT
TGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCA
TGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACA
CCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAA
GAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGT
AAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAA
CAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAA
CAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAA
GAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTC
TCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTC
CCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTC
CCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCT
TCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGC
CCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAG
GAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGA
CTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAG
CCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGG
CAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGGG
GCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCATGTGTATACAAGGAAGC
CAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTGATGGTCCCTCAATTAT

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1998nt
AGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGAC
CCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCG
AAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGT
GCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTG
GGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGT
TGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCA
TGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACA
CCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAA
GAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGT
AAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAA
CAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAA
CAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAA
GAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTC
TCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTC
CCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTC
CCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCT
TCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGC
CCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAG
GAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGA
CTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAG
CCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGG
CAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGGG

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1529nt
AGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGAC
CCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCG
AAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGT
GCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTG
GGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGT
TGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCA
TGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACA
CCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAA
GAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGT
AAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAA
CAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAA
CAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAA
GAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTC
TCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTC
CCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTC
CCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCT

>In-frame_CLCN6_ENST00000376487_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1463nt
AGAGTGGCAGTAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGAC
CCGCACCCCCGAGGAGCTGACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCG
AAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGT
GCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTG
GGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGT
TGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCA
TGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACA
CCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAA
GAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGT
AAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAA
CAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAA
CAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAA
GAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTC
TCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTC
CCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTC
CCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCT

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000251849_chr3_12641914_-_2176nt
AAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTG
ACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCC
TCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGG
GCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAA
GTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAG
GTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTC
ATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACC
AAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGAC
ATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGT
TCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAG
TCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATC
TTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGT
GTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGG
AGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTC
TAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAA
CACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGG
CCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCG
CAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAG
TCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTG
CAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGA
ACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCC
GCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGC
CTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCATGTGTATACAAGGAAGCCAGGAATACAGGTTTTCTT
GATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTGATGGTCCCTCAATTATGTTATTTTAATAAAATAAA

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000442415_chr3_12641914_-_1979nt
AAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTG
ACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCC
TCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGG
GCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAA
GTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAG
GTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTC
ATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACC
AAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGAC
ATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGT
TCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAG
TCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATC
TTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGT
GTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGG
AGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTC
TAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAA
CACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGG
CCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCG
CAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAG
TCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTG
CAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGA
ACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCC

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000534997_chr3_12641914_-_1510nt
AAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTG
ACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCC
TCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGG
GCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAA
GTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAG
GTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTC
ATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACC
AAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGAC
ATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGT
TCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAG
TCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATC
TTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGT
GTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGG
AGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTC
TAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAA
CACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGG

>In-frame_CLCN6_ENST00000376496_chr1_11867247_+_RAF1_ENST00000542177_chr3_12641914_-_1444nt
AAGATGGCGGGGTGCAGGGGGTCTCTGTGCTGCTGCTGCAGGTGGTGCTGCTGCTGCGGTGAGCGTGAGACCCGCACCCCCGAGGAGCTG
ACCATCCTTGGAGAAACACAGGAGGAGGAGGATGAGATTCTTCCAAGGAAAGACTATGAGGATGCAATTCGAAGTCACAGCGAATCAGCC
TCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGG
GCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAA
GTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAG
GTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTC
ATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACC
AAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGAC
ATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGT
TCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAG
TCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATC
TTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGT
GTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGG
AGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTC
TAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAA
CACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGG


Top

FusionGenePPI for CLCN6_RAF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLCN6PPP2R1A, MOV10, ERBB2, ATP6V0A2RAF1YWHAQ, YWHAG, YWHAZ, SFN, HRAS, VDAC1, PEBP4, CNKSR1, RASD2, CNKSR2, ERAS, SPRY4, SPRY2, YWHAB, OIP5, PHKA2, CCT3, MYC, AR, MRAS, KRAS, LRPAP1, RRAS2, SHOC2, TSC22D3, STK26, MAPK1, MAPK3, PRKCE, BCL2, BCL2L1, PEBP1, MAP2K1, GRB10, NRAS, MAPK8IP3, AKT1, HSP90AA1, GNG4, GNB2, VAV1, RHEB, RAP1A, SRC, FYN, RB1, RBL2, PRKG1, JAK2, YWHAH, CFLAR, CDC25A, BRAF, MAP3K1, PDGFRB, MAP3K5, MAPK7, PHB, BAG1, PAK1, PRKCZ, RRAS, PRPF6, UBE2D2, YWHAE, NR3C1, LCK, LTK, JAK1, XIAP, BIRC2, BIRC3, STUB1, EEF1A1, HSPA8, HSPA5, CALM1, SGK1, NEDD4, SCNN1B, NEDD4L, STK3, BRAP, WDR83, KSR1, LATS1, MAP2K2, RFXANK, PPP1CC, VCP, HSPD1, BAD, BCL6, BIRC7, PIN1, MMS19, PPP2R1A, PPP2R2B, PPP2CA, HSPA4, RAF1, PPP2CB, MAPK8, RBBP8, YY1, PKM, CDK20, HIPK4, TBXA2R, SH3KBP1, ILK, GPRASP2, CDC37, IRS4, FAM96B, HUWE1, RANBP9, TMEM70, PACSIN3, NPLOC4, PRKAR1A, DCAF8, PURA, FYCO1, MYBPC1, COPS7A, MOV10, NXF1, EGFR, CALU, CCT8, DNAJA1, EMD, TIMM50, LOX, ARRB2, AGTR1, CASZ1, MRC2, PDLIM2, HERC2, XPO1, ACOX1, PCDH7, MAD2L1, SYNPO, TMEM63B, EEF1E1, COPS5, SS18L2, NUP133, RPGRIP1L, NCAPG2, NUP107, MSH2, LAS1L, AMER1, NUP160, EIF3D, SPATA7, NPHP4, DYNLL2, DYNLL1, IQCB1, RMDN3, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneRAF1chr1:11867247chr3:12641914ENST00000251849-617331_349278649PEBP1/RKIP
TgeneRAF1chr1:11867247chr3:12641914ENST00000442415-718331_349298669PEBP1/RKIP


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLCN6_RAF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneRAF1P04049DB08896RegorafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved
TgeneRAF1P04049DB00398SorafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational
TgeneRAF1P04049DB08862CholecystokininRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational
TgeneRAF1P04049DB08912DabrafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational

Top

RelatedDiseases for CLCN6_RAF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRAF1C1969057Noonan Syndrome 53CTD_human;UNIPROT
TgeneRAF1C0007194Hypertrophic Cardiomyopathy2CTD_human;HPO
TgeneRAF1C0028326Noonan Syndrome2CTD_human;ORPHANET
TgeneRAF1C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneRAF1C0007193Cardiomyopathy, Dilated1CTD_human;HPO
TgeneRAF1C0017638Glioma1CTD_human
TgeneRAF1C0020429Hyperalgesia1CTD_human
TgeneRAF1C0022665Kidney Neoplasm1CTD_human
TgeneRAF1C0023903Liver neoplasms1CTD_human
TgeneRAF1C0024121Lung Neoplasms1CTD_human
TgeneRAF1C0175704LEOPARD Syndrome1CTD_human;ORPHANET
TgeneRAF1C0345967Malignant mesothelioma1CTD_human
TgeneRAF1C1458155Mammary Neoplasms1CTD_human
TgeneRAF1C4014656CARDIOMYOPATHY, DILATED, 1NN1UNIPROT