FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7318

FusionGeneSummary for CLCN3_SMAD1

check button Fusion gene summary
Fusion gene informationFusion gene name: CLCN3_SMAD1
Fusion gene ID: 7318
HgeneTgene
Gene symbol

CLCN3

SMAD1

Gene ID

1182

4086

Gene namechloride voltage-gated channel 3SMAD family member 1
SynonymsCLC3|ClC-3BSP-1|BSP1|JV4-1|JV41|MADH1|MADR1
Cytomap

4q33

4q31.21

Type of geneprotein-codingprotein-coding
DescriptionH(+)/Cl(-) exchange transporter 3chloride channel 3chloride channel protein 3chloride channel, voltage-sensitive 3chloride transporter ClC-3mothers against decapentaplegic homolog 1MAD, mothers against decapentaplegic homolog 1Mad-related protein 1SMAD, mothers against DPP homolog 1TGF-beta signaling protein 1mothers against DPP homolog 1transforming growth factor-beta signaling protein
Modification date2018052320180527
UniProtAcc

P51790

Q15797

Ensembl transtripts involved in fusion geneENST00000513761, ENST00000347613, 
ENST00000360642, ENST00000504131, 
ENST00000506924, 
ENST00000302085, 
ENST00000515527, ENST00000394092, 
ENST00000515385, 
Fusion gene scores* DoF score8 X 7 X 4=2241 X 1 X 1=1
# samples 91
** MAII scorelog2(9/224*10)=-1.31550182572793
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: CLCN3 [Title/Abstract] AND SMAD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCLCN3

GO:1902476

chloride transmembrane transport

11274166

TgeneSMAD1

GO:0007183

SMAD protein complex assembly

9111321

TgeneSMAD1

GO:0010628

positive regulation of gene expression

19664780

TgeneSMAD1

GO:0030509

BMP signaling pathway

8653785|9389648|18548003

TgeneSMAD1

GO:0045944

positive regulation of transcription by RNA polymerase II

12270938


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AN-A04C-01ACLCN3chr4

170557239

+SMAD1chr4

146474936

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000513761ENST00000302085CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000513761ENST00000515527CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000513761ENST00000394092CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000513761ENST00000515385CLCN3chr4

170557239

+SMAD1chr4

146474936

+
In-frameENST00000347613ENST00000302085CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000347613ENST00000515527CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000347613ENST00000394092CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000347613ENST00000515385CLCN3chr4

170557239

+SMAD1chr4

146474936

+
In-frameENST00000360642ENST00000302085CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000360642ENST00000515527CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000360642ENST00000394092CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000360642ENST00000515385CLCN3chr4

170557239

+SMAD1chr4

146474936

+
Frame-shiftENST00000504131ENST00000302085CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000504131ENST00000515527CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000504131ENST00000394092CLCN3chr4

170557239

+SMAD1chr4

146474936

+
5CDS-intronENST00000504131ENST00000515385CLCN3chr4

170557239

+SMAD1chr4

146474936

+
3UTR-3CDSENST00000506924ENST00000302085CLCN3chr4

170557239

+SMAD1chr4

146474936

+
3UTR-intronENST00000506924ENST00000515527CLCN3chr4

170557239

+SMAD1chr4

146474936

+
3UTR-intronENST00000506924ENST00000394092CLCN3chr4

170557239

+SMAD1chr4

146474936

+
3UTR-intronENST00000506924ENST00000515385CLCN3chr4

170557239

+SMAD1chr4

146474936

+

Top

FusionProtFeatures for CLCN3_SMAD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLCN3

P51790

SMAD1

Q15797

Mediates the exchange of chloride ions against protons.Functions as antiporter and contributes to the acidification ofthe endosome and synaptic vesicle lumen, and may thereby affectvesicle trafficking and exocytosis. May play an important role inneuronal cell function through regulation of membrane excitabilityby protein kinase C. It could help neuronal cells to establishshort-term memory. {ECO:0000269|PubMed:11967229}. Transcriptional modulator activated by BMP (bonemorphogenetic proteins) type 1 receptor kinase. SMAD1 is areceptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complexmediates the degradation of the CREBBP/EP300 repressor SNIP1. Mayact synergistically with SMAD4 and YY1 in bone morphogeneticprotein (BMP)-mediated cardiac-specific gene expression.{ECO:0000269|PubMed:12097147}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSMAD1chr4:170557239chr4:146474936ENST00000302085+47418_428332466RegionL3 loop
TgeneSMAD1chr4:170557239chr4:146474936ENST00000394092+47418_428332466RegionL3 loop
TgeneSMAD1chr4:170557239chr4:146474936ENST00000515385+47418_428332466RegionL3 loop

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214658_72253867DomainCBS 1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214755_81253867DomainCBS 2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212658_72253792DomainCBS 1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212755_81253792DomainCBS 2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213658_72253819DomainCBS 1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213755_81253819DomainCBS 2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214241_24853867IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214313_32553867IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214329_33753867IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214572_58653867IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214590_60153867IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214602_60553867IntramembraneNote%3DLoop between two helices
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212241_24853792IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212313_32553792IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212329_33753792IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212572_58653792IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212590_60153792IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212602_60553792IntramembraneNote%3DLoop between two helices
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213241_24853819IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213313_32553819IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213329_33753819IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213572_58653819IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213590_60153819IntramembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213602_60553819IntramembraneNote%3DLoop between two helices
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214238_24253867MotifSelectivity filter part_1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214280_28453867MotifSelectivity filter part_2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214525_52953867MotifSelectivity filter part_3
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212238_24253792MotifSelectivity filter part_1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212280_28453792MotifSelectivity filter part_2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212525_52953792MotifSelectivity filter part_3
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213238_24253819MotifSelectivity filter part_1
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213280_28453819MotifSelectivity filter part_2
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213525_52953819MotifSelectivity filter part_3
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214689_69153867Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214796_79953867Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212689_69153792Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212796_79953792Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213689_69153819Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213796_79953819Nucleotide bindingATP
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+2141_12553867Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214625_81853867Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+2121_12553792Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212625_81853792Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+2131_12553819Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213625_81853819Topological domainCytoplasmic
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214126_16353867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214209_23253867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214258_27653867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214282_30153867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214349_36753867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214391_41653867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214423_44353867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214500_52053867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214525_54453867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000347613+214606_62453867TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212126_16353792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212209_23253792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212258_27653792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212282_30153792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212349_36753792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212391_41653792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212423_44353792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212500_52053792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212525_54453792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000360642+212606_62453792TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213126_16353819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213209_23253819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213258_27653819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213282_30153819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213349_36753819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213391_41653819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213423_44353819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213500_52053819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213525_54453819TransmembraneHelical
HgeneCLCN3chr4:170557239chr4:146474936ENST00000513761+213606_62453819TransmembraneHelical
TgeneSMAD1chr4:170557239chr4:146474936ENST00000302085+47198_201332466Compositional biasNote=Poly-Ser
TgeneSMAD1chr4:170557239chr4:146474936ENST00000302085+4739_45332466Compositional biasNote=Poly-Lys
TgeneSMAD1chr4:170557239chr4:146474936ENST00000394092+47198_201332466Compositional biasNote=Poly-Ser
TgeneSMAD1chr4:170557239chr4:146474936ENST00000394092+4739_45332466Compositional biasNote=Poly-Lys
TgeneSMAD1chr4:170557239chr4:146474936ENST00000515385+47198_201332466Compositional biasNote=Poly-Ser
TgeneSMAD1chr4:170557239chr4:146474936ENST00000515385+4739_45332466Compositional biasNote=Poly-Lys
TgeneSMAD1chr4:170557239chr4:146474936ENST00000302085+4712_136332466DomainMH1
TgeneSMAD1chr4:170557239chr4:146474936ENST00000302085+47271_465332466DomainMH2
TgeneSMAD1chr4:170557239chr4:146474936ENST00000394092+4712_136332466DomainMH1
TgeneSMAD1chr4:170557239chr4:146474936ENST00000394092+47271_465332466DomainMH2
TgeneSMAD1chr4:170557239chr4:146474936ENST00000515385+4712_136332466DomainMH1
TgeneSMAD1chr4:170557239chr4:146474936ENST00000515385+47271_465332466DomainMH2


Top

FusionGeneSequence for CLCN3_SMAD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLCN3_ENST00000513761_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_187aa
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPT
TVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHN

>In-frame_CLCN3_ENST00000347613_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_187aa
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPT
TVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHN

>In-frame_CLCN3_ENST00000360642_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_187aa
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPT
TVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLCN3_ENST00000513761_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_561nt
ATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAGTGATGAGGAACTTTTAGAT
GGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGGAGTTCATCTTTATTATGTT
GGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCATCATGGATTTCATCCTACT
ACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGCACAGTCTGTGAACCATGGA
TTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGAATACCACCGCCAGGATGTT
ACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCAAATGGGTTCACCTCATAAT

>In-frame_CLCN3_ENST00000347613_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_561nt
ATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAGTGATGAGGAACTTTTAGAT
GGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGGAGTTCATCTTTATTATGTT
GGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCATCATGGATTTCATCCTACT
ACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGCACAGTCTGTGAACCATGGA
TTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGAATACCACCGCCAGGATGTT
ACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCAAATGGGTTCACCTCATAAT

>In-frame_CLCN3_ENST00000360642_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_561nt
ATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAGTGATGAGGAACTTTTAGAT
GGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGGAGTTCATCTTTATTATGTT
GGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCATCATGGATTTCATCCTACT
ACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGCACAGTCTGTGAACCATGGA
TTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGAATACCACCGCCAGGATGTT
ACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCAAATGGGTTCACCTCATAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLCN3_ENST00000513761_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_1265nt
GTGACGTCACGCGTCGACGCTGGGGCGTACCTTTCGGGCTCCTGACTCCTGCCGCTTCTCTTCCCCTTCCGTGGGTCAGGGCCGGTCCGG
TCCGGAACCTGCAGCCCCTTTCCCAGTGTTCTAGTTCGCCCGTGACCCGGAATAATGAGCAAGGAGGGTGTGGTGGGTTGAAAGCCATCC
TACTTTACTCCCGAGTTAGAGCATGGATTCAGTTTTAGTCTTAAGGGGGAAGTGAGATTGGAGATTTTTATTTTTAATTTTGGGCAGAAG
CAGGTTGACTCTAGGGATCTCCAGAGCGAGAGGATTTAACTTCATGTTGCTCCCGTGTTTGAAGGAGGACAATAAAAGTCCCACCGGGCA
AAATTTTCGTAACCTCTGCGGTAGAAAACGTCAGGTATCTTTTAAATCGCGATAGTTTTCGCTGTGTCAGGCTTTCTTCGGTGGAGCTCC
GAGGGTAGCTAGGTTCTAGGTTTGAAACAGATGCAGAATCCAAAGGCAGCGCAAAAAACAGCCACCGATTTTGCTATGTCTCTGAGCTGC
GAGATAATCAGACAGCTAAATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAG
TGATGAGGAACTTTTAGATGGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGG
AGTTCATCTTTATTATGTTGGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCA
TCATGGATTTCATCCTACTACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGC
ACAGTCTGTGAACCATGGATTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGA
ATACCACCGCCAGGATGTTACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCA
AATGGGTTCACCTCATAATCCTATTTCATCTGTATCTTAAATGGCCCCAGGCATCTGCCTCTGGAAAACTATTGAGCCTTGCATGTACTT
GAAGGATGGATGAGTCAGACACGATTGAGAACTGACAAAGGAGCCTTGATAATACTTGACCTCTGTGACCAACTGTTGGATTCAGAAATT

>In-frame_CLCN3_ENST00000347613_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_1260nt
GTCACGCGTCGACGCTGGGGCGTACCTTTCGGGCTCCTGACTCCTGCCGCTTCTCTTCCCCTTCCGTGGGTCAGGGCCGGTCCGGTCCGG
AACCTGCAGCCCCTTTCCCAGTGTTCTAGTTCGCCCGTGACCCGGAATAATGAGCAAGGAGGGTGTGGTGGGTTGAAAGCCATCCTACTT
TACTCCCGAGTTAGAGCATGGATTCAGTTTTAGTCTTAAGGGGGAAGTGAGATTGGAGATTTTTATTTTTAATTTTGGGCAGAAGCAGGT
TGACTCTAGGGATCTCCAGAGCGAGAGGATTTAACTTCATGTTGCTCCCGTGTTTGAAGGAGGACAATAAAAGTCCCACCGGGCAAAATT
TTCGTAACCTCTGCGGTAGAAAACGTCAGGTATCTTTTAAATCGCGATAGTTTTCGCTGTGTCAGGCTTTCTTCGGTGGAGCTCCGAGGG
TAGCTAGGTTCTAGGTTTGAAACAGATGCAGAATCCAAAGGCAGCGCAAAAAACAGCCACCGATTTTGCTATGTCTCTGAGCTGCGAGAT
AATCAGACAGCTAAATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAGTGATG
AGGAACTTTTAGATGGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGGAGTTC
ATCTTTATTATGTTGGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCATCATG
GATTTCATCCTACTACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGCACAGT
CTGTGAACCATGGATTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGAATACC
ACCGCCAGGATGTTACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCAAATGG
GTTCACCTCATAATCCTATTTCATCTGTATCTTAAATGGCCCCAGGCATCTGCCTCTGGAAAACTATTGAGCCTTGCATGTACTTGAAGG
ATGGATGAGTCAGACACGATTGAGAACTGACAAAGGAGCCTTGATAATACTTGACCTCTGTGACCAACTGTTGGATTCAGAAATTTAAAC

>In-frame_CLCN3_ENST00000360642_chr4_170557239_+_SMAD1_ENST00000302085_chr4_146474936_+_1257nt
ACGCGTCGACGCTGGGGCGTACCTTTCGGGCTCCTGACTCCTGCCGCTTCTCTTCCCCTTCCGTGGGTCAGGGCCGGTCCGGTCCGGAAC
CTGCAGCCCCTTTCCCAGTGTTCTAGTTCGCCCGTGACCCGGAATAATGAGCAAGGAGGGTGTGGTGGGTTGAAAGCCATCCTACTTTAC
TCCCGAGTTAGAGCATGGATTCAGTTTTAGTCTTAAGGGGGAAGTGAGATTGGAGATTTTTATTTTTAATTTTGGGCAGAAGCAGGTTGA
CTCTAGGGATCTCCAGAGCGAGAGGATTTAACTTCATGTTGCTCCCGTGTTTGAAGGAGGACAATAAAAGTCCCACCGGGCAAAATTTTC
GTAACCTCTGCGGTAGAAAACGTCAGGTATCTTTTAAATCGCGATAGTTTTCGCTGTGTCAGGCTTTCTTCGGTGGAGCTCCGAGGGTAG
CTAGGTTCTAGGTTTGAAACAGATGCAGAATCCAAAGGCAGCGCAAAAAACAGCCACCGATTTTGCTATGTCTCTGAGCTGCGAGATAAT
CAGACAGCTAAATGGAGTCTGAGCAGCTGTTCCATAGAGGCTACTATAGAAACAGCTACAACAGTATAACAAGTGCAAGTAGTGATGAGG
AACTTTTAGATGGAGCAGGTGTTATTATGGACTTTCAAACATCTGAAGATGACAATTTATTAGATGGTGACACTGCAGTTGGAGTTCATC
TTTATTATGTTGGAGGGGAGGTGTATGCCGAATGCCTTAGTGACAGTAGCATCTTTGTGCAAAGTCGGAACTGCAACTACCATCATGGAT
TTCATCCTACTACTGTTTGCAAGATCCCTAGTGGGTGTAGTCTGAAAATTTTTAACAACCAAGAATTTGCTCAGTTATTGGCACAGTCTG
TGAACCATGGATTTGAGACAGTCTATGAGCTTACAAAAATGTGTACTATACGTATGAGCTTTGTGAAGGGCTGGGGAGCAGAATACCACC
GCCAGGATGTTACTAGCACCCCCTGCTGGATTGAGATACATCTGCACGGCCCCCTCCAGTGGCTGGATAAAGTTCTTACTCAAATGGGTT
CACCTCATAATCCTATTTCATCTGTATCTTAAATGGCCCCAGGCATCTGCCTCTGGAAAACTATTGAGCCTTGCATGTACTTGAAGGATG


Top

FusionGenePPI for CLCN3_SMAD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLCN3CLCN3, SLC9A3R1, PDZK1, GOPC, CFTR, LGALS3, LGALS8, LGALS9, LYPD3, HSPB1, TMEM9B, GGA1, TPCN2, TRIM25SMAD1HIPK2, SKI, SMAD4, ZEB1, DVL1, ERBB2IP, TGIF1, EP300, CREBBP, NEUROG1, SNIP1, STAT3, ZNF423, FOXG1, PSMB4, TOB1, RUNX2, SMURF2, HOXC8, RUNX1, RUNX3, ACVR1, BMP7, OAZ3, NEDD9, SMAD6, SMURF1, HOXA5, TCF20, SS18L1, WWP1, NKX3-2, PIAS4, YY1, MED15, MED24, MED6, MECOM, HMGA2, ZCCHC12, KAT2A, OAZ1, HDAC1, KDM6B, NUP214, FOXO3, STUB1, MAPK1, UCHL3, FRZB, USP9X, SKIL, MEN1, NEDD4, USP15, CDK8, CDK7, CDK9, YAP1, HGS, PAX6, SMAD2, SMAD3, BMPR1A, PPM1A, TP53, APP, SMAD1, PSMD11, KMT2D, MAST4, ZEB2, HBP1, SF3B1, PIAS1, AP2A2, SNRNP70, AKR1B1, RFX1, SOX5, ZNF76, XPC, NOTCH2, PUM1, TTF1, CAMSAP1, IRF2BP1, MGA, ZSCAN4, SMARCE1, ANKRD27, INPP4A, PSMD1, SMAD5, PIGQ, ZNF251, ZDHHC3, MKL2, TTF2, ICK, ZNF510, LEMD3, CHMP3, STARD13, GMEB1, ZNF512B, ZNF521, GSK3B, AR, ACVRL1, UBC, WDR77, LEF1, PARD3, XPO1, GLI3, SMAD7, DNMT3L, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLCN3_SMAD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CLCN3_SMAD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCLCN3C0017638Glioma1CTD_human
HgeneCLCN3C0038356Stomach Neoplasms1CTD_human
HgeneCLCN3C2931822Nasopharyngeal carcinoma1CTD_human