FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7301

FusionGeneSummary for CLASP2_GLB1

check button Fusion gene summary
Fusion gene informationFusion gene name: CLASP2_GLB1
Fusion gene ID: 7301
HgeneTgene
Gene symbol

CLASP2

GLB1

Gene ID

23122

2720

Gene namecytoplasmic linker associated protein 2galactosidase beta 1
Synonyms-EBP|ELNR1|MPS4B
Cytomap

3p22.3

3p22.3

Type of geneprotein-codingprotein-coding
DescriptionCLIP-associating protein 2CLIP-associating protein CLASP2multiple asters (Mast)-like homolog 2protein Orbit homolog 2beta-galactosidaseacid beta-galactosidaseelastin receptor 1, 67kDalactase
Modification date2018052220180523
UniProtAcc

O75122

P16278

Ensembl transtripts involved in fusion geneENST00000468888, ENST00000399362, 
ENST00000539981, ENST00000359576, 
ENST00000307312, ENST00000480013, 
ENST00000461133, ENST00000313350, 
ENST00000487200, ENST00000333778, 
ENST00000482896, 
ENST00000307363, 
ENST00000399402, ENST00000445488, 
ENST00000307377, ENST00000497796, 
Fusion gene scores* DoF score3 X 3 X 3=276 X 6 X 4=144
# samples 36
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CLASP2 [Title/Abstract] AND GLB1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGLB1

GO:0044262

cellular carbohydrate metabolic process

11927518


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-DG-A2KL-01ACLASP2chr3

33673784

-GLB1chr3

33114205

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000468888ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000468888ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000468888ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000468888ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000468888ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000399362ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000399362ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000399362ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000399362ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000399362ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
intron-3CDSENST00000539981ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
intron-5UTRENST00000539981ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
intron-5UTRENST00000539981ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
intron-5UTRENST00000539981ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
intron-intronENST00000539981ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000359576ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000359576ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000359576ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000359576ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000359576ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-3CDSENST00000307312ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000307312ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000307312ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000307312ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-intronENST00000307312ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000480013ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000480013ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000480013ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000480013ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000480013ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000461133ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000461133ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000461133ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000461133ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000461133ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000313350ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000313350ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000313350ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000313350ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000313350ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000487200ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000487200ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000487200ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000487200ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000487200ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
In-frameENST00000333778ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000333778ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000333778ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-5UTRENST00000333778ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5CDS-intronENST00000333778ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-3CDSENST00000482896ENST00000307363CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000482896ENST00000399402CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000482896ENST00000445488CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-5UTRENST00000482896ENST00000307377CLASP2chr3

33673784

-GLB1chr3

33114205

-
5UTR-intronENST00000482896ENST00000497796CLASP2chr3

33673784

-GLB1chr3

33114205

-

Top

FusionProtFeatures for CLASP2_GLB1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLASP2

O75122

GLB1

P16278

Isoform 1: Cleaves beta-linked terminal galactosylresidues from gangliosides, glycoproteins, and glycosaminoglycans.{ECO:0000269|PubMed:15714521, ECO:0000269|PubMed:19472408,ECO:0000269|PubMed:2511208, ECO:0000269|PubMed:25936995,ECO:0000269|PubMed:8200356}. Isoform 2: Has no beta-galactosidase catalytic activity,but plays functional roles in the formation of extracellularelastic fibers (elastogenesis) and in the development ofconnective tissue. Seems to be identical to the elastin-bindingprotein (EBP), a major component of the non-integrin cell surfacereceptor expressed on fibroblasts, smooth muscle cells,chondroblasts, leukocytes, and certain cancer cell types. Inelastin producing cells, associates with tropoelastinintracellularly and functions as a recycling molecular chaperonewhich facilitates the secretions of tropoelastin and its assemblyinto elastic fibers. {ECO:0000269|PubMed:10841810,ECO:0000269|PubMed:8922281}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-3131104_110887432Compositional biasNote=Poly-Leu
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313310_58787432Compositional biasNote=Ser-rich
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-3131017_129487432RegionNote=Required for cortical localization
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-31360_31187432RegionTOG 1
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313649_88187432RegionTOG 2
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-3131054_109187432RepeatHEAT 6
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-3131098_113587432RepeatHEAT 7
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-3131216_125387432RepeatHEAT 8
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313173_20887432RepeatHEAT 1
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313209_24587432RepeatHEAT 2
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313250_28787432RepeatHEAT 3
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313710_74787432RepeatHEAT 4
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313772_80987432RepeatHEAT 5


Top

FusionGeneSequence for CLASP2_GLB1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLASP2_ENST00000468888_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_968aa
MEPRSMEYFCAQVQQKDVGGRLQVGQELLLYLGAPGAISDLEEDLGRLGKTVDALTGWVGSSNYRVSLMGLEILSAFVDRLSTRFKSYVA
MVIVALIDRMGDAKDKVRDEAQTLILKLMDQVAPPMYIWEQLASGFKHKNFRSREGVCLCLIETLNIFGAQPLVISKLIPHLCILFGDSN
SQVRDAAILAIVEIYRHVGEKVRMDLYKRGIPPARLEMIFAKFDEVQSSGGMILSVCKDKSFDDEESVDGNRPSSAASAFKVPAPKTSGN
PANSARKPGSAGGPKVGAGASKEGGAGAVDEDDFIKAFTDVPSIQNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLL
KMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDK
WLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITD
AFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEA
GDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPA
PLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAV
CSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMT

>In-frame_CLASP2_ENST00000399362_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_967aa
MEPRSMEYFCAQVQQKDVGGRLQVGQELLLYLGAPGAISDLEEDLGRLGKTVDALTGWVGSSNYRVSLMGLEILSAFVDRLSTRFKSYVA
MVIVALIDRMGDAKDKVRDEAQTLILKLMDQVAPPMYIWEQLASGFKHKNFRSREGVCLCLIETLNIFGAQPLVISKLIPHLCILFGDSN
SQVRDAAILAIVEIYRHVGEKVRMDLYKRGIPPARLEMIFAKFDEVQSSGGMILSVCKDKSFDDEESVDGNRPSSAASAFKVPAPKTSGN
PANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLK
MKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKW
LGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDA
FLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAG
DLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAP
LSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVC
SHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTS

>In-frame_CLASP2_ENST00000359576_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_967aa
MEPRSMEYFCAQVQQKDVGGRLQVGQELLLYLGAPGAISDLEEDLGRLGKTVDALTGWVGSSNYRVSLMGLEILSAFVDRLSTRFKSYVA
MVIVALIDRMGDAKDKVRDEAQTLILKLMDQVAPPMYIWEQLASGFKHKNFRSREGVCLCLIETLNIFGAQPLVISKLIPHLCILFGDSN
SQVRDAAILAIVEIYRHVGEKVRMDLYKRGIPPARLEMIFAKFDEVQSSGGMILSVCKDKSFDDEESVDGNRPSSAASAFKVPAPKTSGN
PANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLK
MKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKW
LGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDA
FLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAG
DLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAP
LSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVC
SHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTS

>In-frame_CLASP2_ENST00000480013_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_734aa
MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNATQRMFEI
DYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGP
YICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDD
VVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVN
LYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCP
SGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVN
YGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFP
GWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPP

>In-frame_CLASP2_ENST00000461133_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_734aa
MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNATQRMFEI
DYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGP
YICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDD
VVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVN
LYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCP
SGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVN
YGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFP
GWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPP

>In-frame_CLASP2_ENST00000313350_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_740aa
MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNAT
QRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLV
ILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFR
HHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILA
RGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAA
LDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVE
NMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQD
TFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVE

>In-frame_CLASP2_ENST00000487200_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_740aa
MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQNAT
QRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLV
ILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFR
HHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILA
RGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAA
LDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVE
NMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQD
TFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVE

>In-frame_CLASP2_ENST00000333778_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_744aa
MLIQRTFISYYISYQNKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSI
QNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHEL
GLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQ
KRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLY
DILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKT
VGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLD
LLVENMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPD
LPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLASP2_ENST00000468888_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2904nt
ATGGAGCCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGCAGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTC
TACCTTGGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACCTGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGT
TCGAGCAACTACCGGGTATCATTAATGGGATTGGAAATTTTAAGTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCA
ATGGTTATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAGACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGAT
CAAGTAGCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTGGTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGT
CTTATTGAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCATCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAAC
AGTCAGGTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTTATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGA
ATTCCCCCTGCTAGATTAGAAATGATATTTGCCAAATTTGATGAAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAA
AGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAAT
CCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGCAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGAT
GAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCC
TTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTG
AAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAG
GACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGG
GAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAG
TGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGC
AGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACT
GATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGAT
GCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCT
CACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGT
GGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCT
GGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCA
AAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGC
CTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCA
CCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTG
ATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAAC
GATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTG
TGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCC
TTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAG
GTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACC
TCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGAC
AGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAA

>In-frame_CLASP2_ENST00000399362_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2901nt
ATGGAGCCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGCAGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTC
TACCTTGGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACCTGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGT
TCGAGCAACTACCGGGTATCATTAATGGGATTGGAAATTTTAAGTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCA
ATGGTTATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAGACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGAT
CAAGTAGCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTGGTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGT
CTTATTGAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCATCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAAC
AGTCAGGTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTTATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGA
ATTCCCCCTGCTAGATTAGAAATGATATTTGCCAAATTTGATGAAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAA
AGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAAT
CCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAA
GATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTC
CTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAG
ATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGAC
CATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAA
ATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGG
TTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGC
TACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGAT
GGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCT
TTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCAC
TCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGG
ACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGG
GACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAG
TTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTT
TATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCT
CTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATC
ACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGAT
TTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGC
AGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTT
TATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTC
TGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCG
GCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGG
CCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGAT

>In-frame_CLASP2_ENST00000359576_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2901nt
ATGGAGCCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGCAGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTC
TACCTTGGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACCTGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGT
TCGAGCAACTACCGGGTATCATTAATGGGATTGGAAATTTTAAGTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCA
ATGGTTATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAGACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGAT
CAAGTAGCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTGGTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGT
CTTATTGAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCATCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAAC
AGTCAGGTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTTATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGA
ATTCCCCCTGCTAGATTAGAAATGATATTTGCCAAATTTGATGAAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAA
AGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAAT
CCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAA
GATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTC
CTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAG
ATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGAC
CATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAA
ATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGG
TTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGC
TACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGAT
GGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCT
TTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCAC
TCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGG
ACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGG
GACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAG
TTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTT
TATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCT
CTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATC
ACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGAT
TTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGC
AGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTT
TATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTC
TGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCG
GCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGG
CCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGAT

>In-frame_CLASP2_ENST00000480013_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2202nt
ATGGCTATGGGAGATGATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCT
GCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGA
GGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATT
GACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTAC
TGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGA
CAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCC
TACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTAC
CTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAG
GTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGAT
GTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACA
GGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTA
GATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAAC
TTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGAT
GCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCT
ATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCC
TCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAA
GATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTC
CTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAAC
TATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTG
GACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCC
AACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCT
GGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCC
CAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGT
GCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCA

>In-frame_CLASP2_ENST00000461133_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2202nt
ATGGCTATGGGAGATGATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCT
GCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGA
GGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATT
GACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTAC
TGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGA
CAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCC
TACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTAC
CTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAG
GTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGAT
GTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACA
GGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTA
GATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAAC
TTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGAT
GCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCT
ATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCC
TCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAA
GATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTC
CTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAAC
TATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTG
GACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCC
AACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCT
GGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCC
CAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGT
GCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCA

>In-frame_CLASP2_ENST00000313350_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2220nt
ATGAGGCGACTGATTTGCAAACGGATCTGTGATTATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCA
TCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGA
GGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACC
CAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCC
CGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTT
CATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTT
ATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGC
TCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGG
CCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGC
CACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACC
ACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAA
TTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCC
CGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCC
ACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAA
AAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCT
CTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTAC
CGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGAT
GGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAG
AACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGAC
TGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCC
TGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGAC
ACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAG
TTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGT
GATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAA

>In-frame_CLASP2_ENST00000487200_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2220nt
ATGAGGCGACTGATTTGCAAACGGATCTGTGATTATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCA
TCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGA
GGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACC
CAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCC
CGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTT
CATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTT
ATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGC
TCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGG
CCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGC
CACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACC
ACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAA
TTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCC
CGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCC
ACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAA
AAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCT
CTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTAC
CGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGAT
GGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAG
AACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGAC
TGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCC
TGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGAC
ACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAG
TTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGT
GATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAA

>In-frame_CLASP2_ENST00000333778_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2232nt
ATGCTTATTCAAAGGACCTTTATTTCGTATTATATATCTTACCAAAATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCA
TCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGC
CCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATT
CAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGC
ATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTG
CCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTG
GGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCT
ATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTAT
CAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAG
AAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAG
GGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTG
ATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTAT
GATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTAT
GCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATC
CAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACA
GTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGG
TTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATAT
GTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGAC
CTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAAT
ATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCAC
CATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGAC
TTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCC
CGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCA
CCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLASP2_ENST00000468888_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_3388nt
GAAAGTTGGCCGCTCACAGACTGGCAGGCGGGCGGGCGGCCGCAGCCATGGAGCCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGC
AGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTCTACCTTGGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACC
TGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGTTCGAGCAACTACCGGGTATCATTAATGGGATTGGAAATTTTAA
GTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCAATGGTTATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAG
ACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGATCAAGTAGCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTG
GTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGTCTTATTGAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCA
TCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAACAGTCAGGTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTT
ATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGAATTCCCCCTGCTAGATTAGAAATGATATTTGCCAAATTTGATG
AAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCAT
CAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTA
AGGTTGGAGCAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTC
AGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCA
TTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGC
CCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGG
GACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTA
TTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATC
AGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGA
AGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGG
GCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGA
TCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATG
ATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATG
CAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCC
AGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAG
TGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGT
TTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATG
TTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACC
TTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATA
TCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACC
ATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACT
TGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCC
GGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCAC
CCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCA
AACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTT
TGAGGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAG
GATGTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACA
GCACAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTT
TTGTTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAG

>In-frame_CLASP2_ENST00000399362_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_3692nt
AGAGGTCCTATCGCTCCCAGCGGTTTCCGCAGCCACCTCCACCACCTCCGCAGCAAAACGCTAGCCGGACTGGAGGGCCCTCGCCGGCGT
CGTGCTGACGTCACGCGCGTGCTGACGTCGCCCGCGGCCGCGGCCTCTGAAGCGGGCTGGGGATCGGGGGGCGCCGAGTTTGACTAGTTT
GGGGGCGGCTGGGCGCTTGGCGTTCCTCCCGCCGCCCGCTGCGCCCCGCAAGCCGCGCCCCTGGCGGGCTAAGTGAGTCCCGCCCGCTCC
CGCGGGGACCCGCACTGGAGGCTGGGCGGCTCTCGGCGAAAGTTGGCCGCTCACAGACTGGCAGGCGGGCGGGCGGCCGCAGCCATGGAG
CCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGCAGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTCTACCTT
GGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACCTGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGTTCGAGC
AACTACCGGGTATCATTAATGGGATTGGAAATTTTAAGTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCAATGGTT
ATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAGACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGATCAAGTA
GCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTGGTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGTCTTATT
GAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCATCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAACAGTCAG
GTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTTATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGAATTCCC
CCTGCTAGATTAGAAATGATATTTGCCAAATTTGATGAAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAAAGCTTC
GATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCC
AACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGAT
TTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAG
GATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAG
ATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGAT
GTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGA
GGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGA
GTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTT
GCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCA
CATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTA
AGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACA
ATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAAT
TTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTC
ACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCA
TATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCC
TTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCT
TCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTG
AACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAG
GGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCAC
CTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATG
GGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATT
AATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCA
AACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTT
ATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGG
CTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGAGGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCA
CTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGATGTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCT
TCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCACAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTA
GTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTGTTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTA
TTGAATTATATGGTCTGACTTAAATCATAACTAGACTTGAGTGGGCTGAATAAACCACTTCACTAACTTGAAGTTCAAAAGGATGGAAAA

>In-frame_CLASP2_ENST00000359576_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_3692nt
AGAGGTCCTATCGCTCCCAGCGGTTTCCGCAGCCACCTCCACCACCTCCGCAGCAAAACGCTAGCCGGACTGGAGGGCCCTCGCCGGCGT
CGTGCTGACGTCACGCGCGTGCTGACGTCGCCCGCGGCCGCGGCCTCTGAAGCGGGCTGGGGATCGGGGGGCGCCGAGTTTGACTAGTTT
GGGGGCGGCTGGGCGCTTGGCGTTCCTCCCGCCGCCCGCTGCGCCCCGCAAGCCGCGCCCCTGGCGGGCTAAGTGAGTCCCGCCCGCTCC
CGCGGGGACCCGCACTGGAGGCTGGGCGGCTCTCGGCGAAAGTTGGCCGCTCACAGACTGGCAGGCGGGCGGGCGGCCGCAGCCATGGAG
CCCCGCAGCATGGAGTACTTCTGCGCCCAGGTGCAGCAGAAGGACGTCGGCGGCCGGCTGCAGGTCGGCCAGGAGCTCCTGCTCTACCTT
GGCGCCCCCGGCGCCATCTCGGACCTGGAGGAGGACCTGGGCCGCCTAGGCAAGACAGTCGACGCGCTCACCGGCTGGGTGGGTTCGAGC
AACTACCGGGTATCATTAATGGGATTGGAAATTTTAAGTGCCTTTGTGGACAGATTATCAACACGCTTTAAATCCTATGTAGCAATGGTT
ATTGTAGCTTTAATAGACAGAATGGGAGATGCCAAAGACAAGGTTCGAGATGAAGCTCAGACTCTGATATTGAAGTTAATGGATCAAGTA
GCACCACCTATGTACATTTGGGAGCAGTTGGCTTCTGGTTTTAAACACAAGAATTTTCGATCTCGAGAAGGCGTGTGTCTGTGTCTTATT
GAAACCTTAAACATTTTTGGGGCTCAGCCACTAGTCATCAGCAAATTGATACCACATTTGTGTATCCTGTTTGGAGACTCCAACAGTCAG
GTGAGAGATGCTGCAATATTGGCTATAGTGGAGATTTATAGACATGTGGGAGAAAAAGTGAGGATGGATCTTTATAAGAGAGGAATTCCC
CCTGCTAGATTAGAAATGATATTTGCCAAATTTGATGAAGTGCAAAGTTCAGGCGGTATGATTTTGAGTGTCTGCAAAGATAAAAGCTTC
GATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCC
AACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGAT
TTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAG
GATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAG
ATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGAT
GTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGA
GGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGA
GTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTT
GCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCA
CATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTA
AGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACA
ATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAAT
TTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTC
ACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCA
TATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCC
TTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCT
TCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTG
AACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAG
GGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCAC
CTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATG
GGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATT
AATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCA
AACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTT
ATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGG
CTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGAGGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCA
CTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGATGTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCT
TCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCACAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTA
GTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTGTTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTA
TTGAATTATATGGTCTGACTTAAATCATAACTAGACTTGAGTGGGCTGAATAAACCACTTCACTAACTTGAAGTTCAAAAGGATGGAAAA

>In-frame_CLASP2_ENST00000480013_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_3091nt
ATTGCTACTGATTACATGGATATCTTTAGGGAAGCAGAAAATGATTGCTGAACACATGCCTTGTGTTTTGATGATTGCATTAAAAGTCCC
CCAGCGGGATGGCATTTATTGGCTCTCAGAGCTTTTCTTAGATTAAATTTCAGGCAGCCAGTACAAGGAGAAACATCATAACCTGTATCC
AACAGCATATGTGCAGCTAAAGAGTAATCTTAATCAAGTCCTTCTAGGCTGTGCTAAATAAACGAGGGTTTTCAGCAAGACCCCAGACTT
TTATTTTGAAGTGGAGTAGCAGCTGTTGGCTATTGCGGTGCAGAGCTGCAGCGAGGCCTGGGTCACACAGTGCTCCGGGTGTCTGCAGGC
TGCAGGCCGAGCCCAGTGGCGCAGGCACTGAGCTGTACTTATTTGCTGTGCTATTTGACCTCTTGGTTTCAGAGAGCTCCCTGGACCATC
TAATGGCTATGGGAGATGATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTC
CTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAG
GAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAA
TTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCT
ACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAG
GACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGC
CCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATT
ACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGC
AGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATG
ATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAA
CAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGC
TAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGA
ACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATG
ATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTC
CTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTC
CCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTC
AAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAG
TCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGA
ACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCAC
TGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCAT
CCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTC
CTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGC
CCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTAT
GTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCC
CACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGAGGGATTCTACCCTGAACATACCTC
ACAGATCCTCCCTGTCATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGATGTGCATTTTCACCTGAGGTTTCCC
TGCATCCCTGCAGTGCCAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCACAGTAACGTGCATACATATCTGCA
GGGCTGGAATGGAAGCTTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTGTTAAATAAAATTTGTACTCAAATG
ATGATGTCACTGTTTTTAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAGACTTGAGTGGGCTGAATAAACCACTTC

>In-frame_CLASP2_ENST00000461133_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2755nt
ACAGTGCTCCGGGTGTCTGCAGGCTGCAGGCCGAGCCCAGTGGCGCAGGCACTGAGCTGTACTTATTTGCTGTGCTATTTGACCTCTTGG
TTTCAGAGAGCTCCCTGGACCATCTAATGGCTATGGGAGATGATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCAT
CAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTA
AGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGA
ATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTC
ACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCT
GGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGAC
TGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTC
TTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGA
ATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGC
GCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCC
TCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCA
ATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATA
TACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAG
CACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGA
AGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGG
GAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTG
TGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTG
CTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTC
TGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCC
TCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATG
ATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGC
CCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGG
GCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCT
GCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAAC
CTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGA
GGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGAT
GTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCA
CAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTG
TTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAGACT

>In-frame_CLASP2_ENST00000313350_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2834nt
ACAGCACCTAGGGCAGGGAAGAGAAAGAAAAATGCCGGCACAAACCTCAGTGGTGGTTCTGTGGTTGTTTCTGTCTTTTTTTGATAGAAT
CTTTGATTAGTATCGAATTTACTGTATTTGGCCATGTGAACTATTGGGAGCCTCCTAGGGTGAGGGAAATTAAGAGCTTTCAGAGGAATG
AGGCGACTGATTTGCAAACGGATCTGTGATTATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCA
GCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGT
GCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAG
AGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGT
GTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCAT
GAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATC
CTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCC
TCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCA
GTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCAC
CATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACG
GTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTC
TATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGT
GGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACC
AGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAA
GTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTG
GACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGG
ACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGG
ATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAAC
ATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGG
ACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGG
GCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACC
TTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTG
ACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGAT
GATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAA
AGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGAGGGATTCTACC
CTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGATGTGCATTTTCA
CCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCACAGTAACGTGC
ATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTGTTAAATAAAAT
TTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAGACTTGAGTGGGCTG

>In-frame_CLASP2_ENST00000487200_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2845nt
GATTGGCTGTTACAGCACCTAGGGCAGGGAAGAGAAAGAAAAATGCCGGCACAAACCTCAGTGGTGGTTCTGTGGTTGTTTCTGTCTTTT
TTTGATAGAATCTTTGATTAGTATCGAATTTACTGTATTTGGCCATGTGAACTATTGGGAGCCTCCTAGGGTGAGGGAAATTAAGAGCTT
TCAGAGGAATGAGGCGACTGATTTGCAAACGGATCTGTGATTATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCAT
CAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATCCGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTA
AGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGTTGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGA
ATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTC
ACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCT
GGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGAC
TGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTC
TTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGA
ATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGC
GCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCC
TCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCA
ATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATA
TACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAG
CACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGA
AGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGG
GAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTG
TGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTG
CTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTC
TGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCC
TCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATG
ATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGC
CCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGG
GCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCT
GCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAAC
CTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGA
GGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTCATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGAT
GTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGCCAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCA
CAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGCTTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTG
TTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTTTAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAGACT

>In-frame_CLASP2_ENST00000333778_chr3_33673784_-_GLB1_ENST00000307363_chr3_33114205_-_2895nt
GCAGAATCTGGGTATAAGGAATAAGGCAGGGCGTGCTAGAAGATACACTATGGGAGGAGCTGGCAGAAAATGCAGAGTAGCAAAAACATG
AAAAATACTTTTACTACCTTTAGAGTTAAAATGTTTTATGTTTTGACTTAATATGTATAAGTAAGAAGTATGAAAATACTGCATTTTGAT
TTTGAATTACAGAGGATTATTTTATATGGTGTTAGCCAATATATAAATGCTTATTCAAAGGACCTTTATTTCGTATTATATATCTTACCA
AAATAAAAGCTTCGATGATGAAGAATCAGTGGATGGAAATAGGCCATCATCAGCTGCATCAGCCTTCAAGGTTCCTGCACCTAAAACATC
CGGAAATCCTGCCAACAGTGCAAGGAAGCCTGGTTCAGCAGGTGGCCCTAAGGTTGGAGGTGCTTCTAAGGAAGGAGGTGCTGGAGCAGT
TGATGAAGATGATTTTATAAAAGCTTTTACAGATGTCCCTTCTATTCAGAATGCCACCCAGAGGATGTTTGAAATTGACTATAGCCGGGA
CTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAAGCATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCT
GCTGAAGATGAAGATGGCTGGGCTGAACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTC
TGAGGACCATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGCCCTACATCTGTGCAGA
GTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCTCCGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGA
CAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAGCCTCTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATA
TGGCAGCTACTTTGCCTGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCTGTTTAC
CACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTGGACTTTGGAACAGGCAGCAACATCAC
AGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCTTGATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCA
ACCTCACTCCACAATCAAGACCGAAGCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTAT
AGGTGGGACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATGATGCCCCACTGAGTGA
GGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTTTGAAAAAGTACCAGAAGGTCCTATCCCTCCATCTAC
ACCAAAGTTTGCATATGGAAAGGTCACTTTGGAAAAGTTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAA
AAGCCTTTATCCCTTGACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAGCAACCC
AGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATCCCCCAGGGAGTCCTTGAGCGAAACAA
TGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGGACCTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATAT
CAACGATTTTAAGGGTTTGGTTTCTAACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGC
AGTGTGCAGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCATCCAACTACACGCTCCC
GGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCAGGACACCTTTATCCAGTTTCCTGGATGGACCAAGGG
CCAGGTCTGGATTAATGGCTTTAACCTTGGCCGCTATTGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGAT
GACCTCGGCCCCAAACACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGACGTTCGT
GGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGACTCATGCCCCCACCCCCGCAAAAAAA
CAAAGATTCATGGCTGGACCATGTATGATGATGAAAGCCTGTGTCTTTGAGGGATTCTACCCTGAACATACCTCACAGATCCTCCCTGTC
ATGCCACATTTCACTGATTGGAATGTGGAAATGGAAAAGGAATTTAGGATGTGCATTTTCACCTGAGGTTTCCCTGCATCCCTGCAGTGC
CAAAGCCCCACCTTCAGGGACCACCTGGAATGTGTGAGGGGCTGACAGCACAGTAACGTGCATACATATCTGCAGGGCTGGAATGGAAGC
TTTAAAGGTGGTAGTGATTTTTATTTTGGAAGAATCATGTTACCTTTTTGTTAAATAAAATTTGTACTCAAATGATGATGTCACTGTTTT
TAATGTGCAGGTATTGAATTATATGGTCTGACTTAAATCATAACTAGACTTGAGTGGGCTGAATAAACCACTTCACTAACTTGAAGTTCA


Top

FusionGenePPI for CLASP2_GLB1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLASP2SMYD2, LXN, CLIP2, MARK2, FEZ1, FEZ2, RAD21, TP53BP1, SMURF1, CSNK2A1, YWHAE, GRB2, MPG, PAN2, YWHAB, ASB3, GSK3B, MOV10, NXF1, MAPRE1, LYPD3, GOPC, FAM43A, NTRK1, AKT1, SRPK2, NIN, DCTN1, XPO1, CENPE, CENPJ, RC3H1, C10orf76, PPP4C, KLHDC3, CSGALNACT2, GORASP1, ID2, DCAF7GLB1CTNNBIP1, NEU1, H2AFX, CSNK2B, TK1, PLK1, FBXO6, FOS, MEPCE, VCP, ABCE1, DNAJB2, DNAJB4, LGALS3, VAPA, ATP6AP2, C7orf43, TRAPPC10, TRAPPC9, TRAPPC6B, KLHDC9, TRAPPC1, TRAPPC4, TRAPPC3, TRAPPC2L, KHK, RHOC, SFXN5, FZR1, RHOA, DNAJB1, PLAUR, TRAPPC5, PVRL4, TRAPPC2, RORC, CDK2, PTPN7, YPEL5, CTSA, VIM, XPNPEP3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313444_58087432microtubules%2C MAPRE1 and MAPRE3
HgeneCLASP2chr3:33673784chr3:33114205ENST00000313350-313872_129487432RSN and localization to the Golgi and kinetochores


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLASP2_GLB1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CLASP2_GLB1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGLB1C0268271Gangliosidosis, Generalized GM1, Type 1 (disorder)23ORPHANET;UNIPROT
TgeneGLB1C0268272Gangliosidosis, Generalized GM1, Type 214ORPHANET;UNIPROT
TgeneGLB1C0086652Mucopolysaccharidosis type IVB13ORPHANET;UNIPROT
TgeneGLB1C0268273Gangliosidosis, Generalized GM1, Type 313ORPHANET;UNIPROT
TgeneGLB1C0026707Mucopolysaccharidosis IV2CTD_human
TgeneGLB1C0005941Bone Diseases, Developmental1CTD_human
TgeneGLB1C0010038Corneal Opacity1CTD_human
TgeneGLB1C0011615Dermatitis, Atopic1CTD_human
TgeneGLB1C0011616Contact Dermatitis1CTD_human
TgeneGLB1C0029422Osteochondrodysplasias1CTD_human