FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7278

FusionGeneSummary for CKAP5_DAAM1

check button Fusion gene summary
Fusion gene informationFusion gene name: CKAP5_DAAM1
Fusion gene ID: 7278
HgeneTgene
Gene symbol

CKAP5

DAAM1

Gene ID

9793

23002

Gene namecytoskeleton associated protein 5dishevelled associated activator of morphogenesis 1
SynonymsCHTOG|MSPS|TOG|TOGp|ch-TOG-
Cytomap

11p11.2

14q23.1

Type of geneprotein-codingprotein-coding
Descriptioncytoskeleton-associated protein 5colonic and hepatic tumor over-expressed gene proteincolonic and hepatic tumor overexpressed gene proteindisheveled-associated activator of morphogenesis 1
Modification date2018052320180519
UniProtAcc

Q14008

Q9Y4D1

Ensembl transtripts involved in fusion geneENST00000529230, ENST00000415402, 
ENST00000312055, ENST00000354558, 
ENST00000532321, 
ENST00000360909, 
ENST00000351081, ENST00000395125, 
ENST00000556135, ENST00000553966, 
Fusion gene scores* DoF score4 X 4 X 4=644 X 6 X 3=72
# samples 56
** MAII scorelog2(5/64*10)=-0.356143810225275
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/72*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CKAP5 [Title/Abstract] AND DAAM1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2A6-06ACKAP5chr11

46842726

-DAAM1chr14

59797927

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000529230ENST00000360909CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000529230ENST00000351081CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000529230ENST00000395125CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000529230ENST00000556135CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000529230ENST00000553966CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000415402ENST00000360909CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000415402ENST00000351081CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000415402ENST00000395125CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000415402ENST00000556135CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000415402ENST00000553966CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000312055ENST00000360909CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000312055ENST00000351081CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000312055ENST00000395125CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000312055ENST00000556135CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000312055ENST00000553966CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000354558ENST00000360909CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000354558ENST00000351081CKAP5chr11

46842726

-DAAM1chr14

59797927

+
In-frameENST00000354558ENST00000395125CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000354558ENST00000556135CKAP5chr11

46842726

-DAAM1chr14

59797927

+
5CDS-intronENST00000354558ENST00000553966CKAP5chr11

46842726

-DAAM1chr14

59797927

+
intron-3CDSENST00000532321ENST00000360909CKAP5chr11

46842726

-DAAM1chr14

59797927

+
intron-3CDSENST00000532321ENST00000351081CKAP5chr11

46842726

-DAAM1chr14

59797927

+
intron-3CDSENST00000532321ENST00000395125CKAP5chr11

46842726

-DAAM1chr14

59797927

+
intron-intronENST00000532321ENST00000556135CKAP5chr11

46842726

-DAAM1chr14

59797927

+
intron-intronENST00000532321ENST00000553966CKAP5chr11

46842726

-DAAM1chr14

59797927

+

Top

FusionProtFeatures for CKAP5_DAAM1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CKAP5

Q14008

DAAM1

Q9Y4D1

Binds to the plus end of microtubules and regulatesmicrotubule dynamics and microtubule organization. Acts asprocessive microtubule polymerase. Promotes cytoplasmicmicrotubule nucleation and elongation. Plays a major role inorganizing spindle poles. In spindle formation protectskinetochore microtubules from depolymerization by KIF2C and has anessential role in centrosomal microtubule assembly independentlyof KIF2C activity. Contributes to centrosome integrity. Acts ascomponent of the TACC3/ch-TOG/clathrin complex proposed tocontribute to stabilization of kinetochore fibers of the mitoticspindle by acting as inter-microtubule bridge. The TACC3/ch-TOG/clathrin complex is required for the maintenance ofkinetochore fiber tension (PubMed:23532825). Enhances the strengthof NDC80 complex-mediated kinetochore-tip microtubule attachments(PubMed:27156448). {ECO:0000269|PubMed:12569123,ECO:0000269|PubMed:18809577, ECO:0000269|PubMed:21297582,ECO:0000269|PubMed:21646404, ECO:0000269|PubMed:23532825,ECO:0000269|PubMed:27156448, ECO:0000269|PubMed:9570755}. Binds to disheveled (Dvl) and Rho, and mediates Wnt-induced Dvl-Rho complex formation. May play a role as ascaffolding protein to recruit Rho-GDP and Rho-GEF, therebyenhancing Rho-GTP formation. Can direct nucleation and elongationof new actin filaments. Involved in building functional cilia(PubMed:16630611, PubMed:17482208). Involved in the organizationof the subapical actin network in multiciliated epithelial cells(By similarity). Together with DAAM2, required for myocardialmaturation and sarcomere assembly (By similarity).{ECO:0000250|UniProtKB:B0DOB5, ECO:0000250|UniProtKB:Q8BPM0,ECO:0000269|PubMed:16630611, ECO:0000269|PubMed:17482208}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+1226528_5935201079Compositional biasNote=Pro-rich
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+1225528_5935201069Compositional biasNote=Pro-rich
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+1125528_5935201079Compositional biasNote=Pro-rich
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+12261027_10585201079DomainDAD
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+1226528_5995201079DomainNote=FH1
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+1226600_10095201079DomainFH2
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+12251027_10585201069DomainDAD
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+1225528_5995201069DomainNote=FH1
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+1225600_10095201069DomainFH2
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+11251027_10585201079DomainDAD
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+1125528_5995201079DomainNote=FH1
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+1125600_10095201079DomainFH2
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+1226693_7025201079RegionNote=Actin-binding
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+1225693_7025201069RegionNote=Actin-binding
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+1125693_7025201079RegionNote=Actin-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431193_1428191973RegionTOG 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431_223191973RegionTOG 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243268_502191973RegionTOG 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243588_817191973RegionTOG 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243853_1081191973RegionTOG 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421193_1428191973RegionTOG 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421_223191973RegionTOG 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142268_502191973RegionTOG 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142588_817191973RegionTOG 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142853_1081191973RegionTOG 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441193_1428192040RegionTOG 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441_223192040RegionTOG 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244268_502192040RegionTOG 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244588_817192040RegionTOG 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244853_1081192040RegionTOG 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441193_1428192033RegionTOG 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441_223192033RegionTOG 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244268_502192033RegionTOG 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244588_817192033RegionTOG 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244853_1081192033RegionTOG 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431013_1051191973RepeatNote=HEAT 7
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431284_1322191973RepeatNote=HEAT 8
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431324_1357191973RepeatNote=HEAT 9
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431361_1399191973RepeatNote=HEAT 10
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243159_197191973RepeatNote=HEAT 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243356_394191973RepeatNote=HEAT 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243434_472191973RepeatNote=HEAT 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243750_788191973RepeatNote=HEAT 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243855_893191973RepeatNote=HEAT 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-243936_974191973RepeatNote=HEAT 6
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421013_1051191973RepeatNote=HEAT 7
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421284_1322191973RepeatNote=HEAT 8
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421324_1357191973RepeatNote=HEAT 9
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421361_1399191973RepeatNote=HEAT 10
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142159_197191973RepeatNote=HEAT 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142356_394191973RepeatNote=HEAT 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142434_472191973RepeatNote=HEAT 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142750_788191973RepeatNote=HEAT 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142855_893191973RepeatNote=HEAT 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-142936_974191973RepeatNote=HEAT 6
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441013_1051192040RepeatNote=HEAT 7
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441284_1322192040RepeatNote=HEAT 8
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441324_1357192040RepeatNote=HEAT 9
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441361_1399192040RepeatNote=HEAT 10
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244159_197192040RepeatNote=HEAT 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244356_394192040RepeatNote=HEAT 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244434_472192040RepeatNote=HEAT 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244750_788192040RepeatNote=HEAT 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244855_893192040RepeatNote=HEAT 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-244936_974192040RepeatNote=HEAT 6
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441013_1051192033RepeatNote=HEAT 7
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441284_1322192033RepeatNote=HEAT 8
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441324_1357192033RepeatNote=HEAT 9
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441361_1399192033RepeatNote=HEAT 10
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244159_197192033RepeatNote=HEAT 1
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244356_394192033RepeatNote=HEAT 2
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244434_472192033RepeatNote=HEAT 3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244750_788192033RepeatNote=HEAT 4
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244855_893192033RepeatNote=HEAT 5
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-244936_974192033RepeatNote=HEAT 6
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+1226437_5265201079Coiled coilOntology_term=ECO:0000255
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+1225437_5265201069Coiled coilOntology_term=ECO:0000255
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+1125437_5265201079Coiled coilOntology_term=ECO:0000255
TgeneDAAM1chr11:46842726chr14:59797927ENST00000351081+122645_4205201079DomainGBD/FH3
TgeneDAAM1chr11:46842726chr14:59797927ENST00000360909+122545_4205201069DomainGBD/FH3
TgeneDAAM1chr11:46842726chr14:59797927ENST00000395125+112545_4205201079DomainGBD/FH3


Top

FusionGeneSequence for CKAP5_DAAM1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_568aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQKEADAIDDTLSSKLKVKELSVIDGR
RAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQQRLQSLYFKK
KFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLITIVENKYPSV
LNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFG
EEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDLS

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_568aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQKEADAIDDTLSSKLKVKELSVIDGR
RAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQQRLQSLYFKK
KFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLITIVENKYPSV
LNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFG
EEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDLS

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_568aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQKEADAIDDTLSSKLKVKELSVIDGR
RAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQQRLQSLYFKK
KFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLITIVENKYPSV
LNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFG
EEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDLS

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_568aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQKEADAIDDTLSSKLKVKELSVIDGR
RAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQQRLQSLYFKK
KFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLITIVENKYPSV
LNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFG
EEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDLS

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_578aa
MGDDSEWLKLPVDQKCEHKRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG
APMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSATQRQQDFFVNSNSKQKEADAIDDTLSSKLK
VKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHTQ
QRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNTMNKGQRGNATGFKISSLNKIADTKSSIDKNITLLHTLI
TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELETQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKD
LFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_1704nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGG
AGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAA
GATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTG
GATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAG
AAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAG
CAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAAC
AAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTT
CTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGT
GGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTC
ATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGG
GAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAA
AATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGA
AAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCT

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_1704nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGG
AGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAA
GATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTG
GATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAG
AAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAG
CAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAAC
AAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTT
CTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGT
GGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTC
ATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGG
GAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAA
AATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGA
AAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCT

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_1704nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGG
AGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAA
GATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTG
GATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAG
AAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAG
CAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAAC
AAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTT
CTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGT
GGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTC
ATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGG
GAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAA
AATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGA
AAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCT

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_1704nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGG
AGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAA
GATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTG
GATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAG
AAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAG
CAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAAC
AAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTT
CTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGT
GGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTC
ATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGG
GAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAA
AATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGA
AAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCT

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_1734nt
ATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCC
TCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATG
CTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGT
GCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAAC
AAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCC
TATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAA
GTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAA
CGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATT
GACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAG
CAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCA
GAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAAT
GCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATC
ACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAG
CTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGA
GATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGAC
CTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAA
GCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAA
GAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGC
TCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_2645nt
CCCAGCTGAGGAAATACTCTTAATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGA
AATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTG
GATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTC
CTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGC
CCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAG
TCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTC
TGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTAT
CCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTC
CTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCC
GAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAG
CAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATA
AAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCC
TTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGA
AAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTC
AGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTC
TAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTT
TTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCA
TGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACC
TTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTG
ACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTAAAG
TGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTATGT
AAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGTTAA
TGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCACAA
TACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAAAAT
ATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGATTTT
TGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGTAAA
TGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTTTTC
CCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCATGCT
TTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAGACT

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_2675nt
CCCAGCTGAGGAAATACTCTTAATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGA
AATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTG
GATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTC
CTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGC
CCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAG
TCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGC
AGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATT
GCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGG
ACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCA
AGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGC
GTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGG
TGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACA
CAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATG
AAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAG
TAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCA
GCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCA
AAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGA
AAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGA
ATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGA
ATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTT
TTTAGAAAGCTCATTAGCAGCCCTCTAAAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCAT
CTGTGAGTGAATGTGTGAACGTGTGTATGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACC
TATACGTATGGTTAAAAAGATTTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTC
CCCGAACGCCATGACTGTTCAGAAGCACAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAAC
AAACAAACAAACAAAAAAAGCTTGCAAAATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTT
GTTGGAAAAACATAGATTTAAAATGATTTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTC
TGACATTGGTGTGGGGATACAGTCTGTAAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTG
TATATTTAAAAGTTGGACATCAATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGA
AAAAAACACTATATAAATGCAATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCT

>In-frame_CKAP5_ENST00000529230_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_4327nt
CCCAGCTGAGGAAATACTCTTAATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGA
AATGTGAACACAAGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTG
GATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTC
CTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGC
CCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAG
TCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGC
AGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATT
GCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGG
ACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCA
AGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGC
GTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGG
TGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACA
CAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATG
AAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAG
TAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCA
GCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCA
AAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGA
AAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGA
ATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGA
ATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTT
TTTAGAAAGCTCATTAGCAGCCCTCTAAAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCAT
CTGTGAGTGAATGTGTGAACGTGTGTATGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACC
TATACGTATGGTTAAAAAGATTTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTC
CCCGAACGCCATGACTGTTCAGAAGCACAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAAC
AAACAAACAAACAAAAAAAGCTTGCAAAATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTT
GTTGGAAAAACATAGATTTAAAATGATTTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTC
TGACATTGGTGTGGGGATACAGTCTGTAAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTG
TATATTTAAAAGTTGGACATCAATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGA
AAAAAACACTATATAAATGCAATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCT
TAAAAATAATAAAATATCTCACCCAAGACTTAAAGGAAGAATTCTCTGAAGGGATAAAGATTACTAAAAAAAAAAAAAAAAAAAAAAAAT
TAATGGGGTGCCTTTTTGTTATAGTTTCTATTTTCTGTTTTGTAGGACAAGCTGCATTTTCTGTAAATATAGGTCTGGACTAAAGGATAC
ATAAAGAATGCACAAAATGTCAACATCAGCAGAGATGCCCAGATCTATTTATCTCTAAGTATATTTGAAGTGATTGCTGTTTATATGTTG
TCATTTTAAAATTGTGTGTCAGTAAAGCTACCTGTAAAATTTCAGTCCAAAAAAATAAAGCTCTCAGGGAGACATGAATAAAATCAATGA
ACATTAGAAAATAAAATATAGATGCTTACCATTAACCTACCAACTCTTAATATCCTTAAATTATGTGATATATAAAGAGGACTGTTACTT
TTTTACTTTTTTTTTTTTTTTTTTTTTTTTTTGGCTTTGCTTTATTTATTTGTAGTTGGGGGCTAACGTTTTCTCTTTTCTTTCTATTGA
TCCTGTTGTGGTTGGGTTTCCTGTGGAGAGAGTAGTTTGTCCTGTTGCACTAGAACATTATTTACTCACTAAATTGAGTTTTTCAGTCAA
TTAACAAATATTTATTAAGTTCCTACTATGTACCAGGCATAGTAGGGCTACAATGGTAAGCAAGACAGAGTCCCTGCCCCCAAAGAGCTT
ATATTCTAATGGGGATATTAAGGGATGAATAGAATACCAATGTGTGCACTGTACAGGAATCATACTATTTAAAAATAATTTGTATAAACT
ATAATGCTTAGCACAGATGGCGAGTTATCTGTGCTATGTGAAAGCTGTGAAATAGTGCTCTAAGAGTTGTCAAGAGCTGTGGTTTTACAT
CTTTTCCTCATTGCAAATTTAGTGACTTTCTACACACTATATGGAAATAAATGACTAGCAAATAAAACAGTCATAAATACAAAGCAGAGG
TTGCACTCCCCCAATCCCGAGTTAACCCAGGTCTGCAATAACACCATGTTAAAGGTGCAGATAGAGACTTGGCTCAAAAAGGCTTGGAGA
TGAGGAAGATTGGAATATAATGATGGTTTTGTCTGTTCCTTAACTAAAGTGCCTCTATGTATATTCTTTTCTATTTGTAGCAGGATAAAT
TTGGTCTGGCTCAGTTTTGGAACTGTATTTTGAAAATGGCTTTGTCTTACAGTTTAAGGAATAGACAGGTGGAGGGAAAGTCACATAAAG
GAGCAAGTTTGTGTAGCTGTCCCTCTTGCCCCTTTTAATCATCCTCCTTTGATATGGCCATCCTGGTGGGCCTCCTTTGCCATTTCCATT
TTTGGTTTCTTTCCCTGAAAACTGTGTGCAGGTAATTCCATGTGCCATTGTTGAAAAGAAAAAAAAAAAACAAAAAAAAAACCTACTTTT
TAGATTGGTGCTGGTGTAAGTAGCCACTTTTCTCTCTTGGGTGTGTATTTTAAACTTTTTTTGTTTTTTTAAATTAATGCCAAAAAGAAA
ATGCATAATTTGTAAACTTAATTATATGTCTTATATCTTATTAGCTTAGTAGTTGGAACCACTTAGTCTTTAGGTGCAAGACTGTTGTTA
GATAGTACTGAGAAAAAAAAAGTATGTGTTATGAGACTGTACATGTTTTTTTAAAAATAGCAATATGCAATAAAGAGATGAATTCATTGG

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_2708nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGC
TTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTC
TAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGG
AGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGC
AATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGT
TTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGAT
TCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGG
AAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAG
AAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTG
TGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTA
AAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAG
AAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTG
AAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAG
TGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCACAA
AACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTAAAGTGACTAGAACGTTTCATTACACTGCCT
TGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTATGTAAATGTATGTGTGTATATATTAAAAAA
TGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTA
TGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCACAATACTATCTCCTGAAAGAGATAAGAGAC
ATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAAAATATTTTATGGTTTCCAAGCTTGATATCC
TTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGATTTTTGATAGCTGACATTGTGATGTTGATGT
ATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGTAAATGTTTATTGAGAACATCTTGCACACAA
TTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCC
AAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGT
ATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAGACTTAAAGGAAGAATTCTCTGAAGGGATAA

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_2738nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACA
CTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAAT
TATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTG
TTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGA
GCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGG
AAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGA
ATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTA
CCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTG
CGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGT
CTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACC
TTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCA
TTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTC
GCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATG
ACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGA
CTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTA
AAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTA
TGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGT
TAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCA
CAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAA
AATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGAT
TTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGT
AAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTT
TTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCAT
GCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAG

>In-frame_CKAP5_ENST00000415402_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_4390nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACA
CTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAAT
TATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTG
TTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGA
GCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGG
AAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGA
ATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTA
CCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTG
CGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGT
CTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACC
TTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCA
TTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTC
GCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATG
ACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGA
CTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTA
AAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTA
TGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGT
TAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCA
CAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAA
AATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGAT
TTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGT
AAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTT
TTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCAT
GCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAG
ACTTAAAGGAAGAATTCTCTGAAGGGATAAAGATTACTAAAAAAAAAAAAAAAAAAAAAAAATTAATGGGGTGCCTTTTTGTTATAGTTT
CTATTTTCTGTTTTGTAGGACAAGCTGCATTTTCTGTAAATATAGGTCTGGACTAAAGGATACATAAAGAATGCACAAAATGTCAACATC
AGCAGAGATGCCCAGATCTATTTATCTCTAAGTATATTTGAAGTGATTGCTGTTTATATGTTGTCATTTTAAAATTGTGTGTCAGTAAAG
CTACCTGTAAAATTTCAGTCCAAAAAAATAAAGCTCTCAGGGAGACATGAATAAAATCAATGAACATTAGAAAATAAAATATAGATGCTT
ACCATTAACCTACCAACTCTTAATATCCTTAAATTATGTGATATATAAAGAGGACTGTTACTTTTTTACTTTTTTTTTTTTTTTTTTTTT
TTTTTGGCTTTGCTTTATTTATTTGTAGTTGGGGGCTAACGTTTTCTCTTTTCTTTCTATTGATCCTGTTGTGGTTGGGTTTCCTGTGGA
GAGAGTAGTTTGTCCTGTTGCACTAGAACATTATTTACTCACTAAATTGAGTTTTTCAGTCAATTAACAAATATTTATTAAGTTCCTACT
ATGTACCAGGCATAGTAGGGCTACAATGGTAAGCAAGACAGAGTCCCTGCCCCCAAAGAGCTTATATTCTAATGGGGATATTAAGGGATG
AATAGAATACCAATGTGTGCACTGTACAGGAATCATACTATTTAAAAATAATTTGTATAAACTATAATGCTTAGCACAGATGGCGAGTTA
TCTGTGCTATGTGAAAGCTGTGAAATAGTGCTCTAAGAGTTGTCAAGAGCTGTGGTTTTACATCTTTTCCTCATTGCAAATTTAGTGACT
TTCTACACACTATATGGAAATAAATGACTAGCAAATAAAACAGTCATAAATACAAAGCAGAGGTTGCACTCCCCCAATCCCGAGTTAACC
CAGGTCTGCAATAACACCATGTTAAAGGTGCAGATAGAGACTTGGCTCAAAAAGGCTTGGAGATGAGGAAGATTGGAATATAATGATGGT
TTTGTCTGTTCCTTAACTAAAGTGCCTCTATGTATATTCTTTTCTATTTGTAGCAGGATAAATTTGGTCTGGCTCAGTTTTGGAACTGTA
TTTTGAAAATGGCTTTGTCTTACAGTTTAAGGAATAGACAGGTGGAGGGAAAGTCACATAAAGGAGCAAGTTTGTGTAGCTGTCCCTCTT
GCCCCTTTTAATCATCCTCCTTTGATATGGCCATCCTGGTGGGCCTCCTTTGCCATTTCCATTTTTGGTTTCTTTCCCTGAAAACTGTGT
GCAGGTAATTCCATGTGCCATTGTTGAAAAGAAAAAAAAAAAACAAAAAAAAAACCTACTTTTTAGATTGGTGCTGGTGTAAGTAGCCAC
TTTTCTCTCTTGGGTGTGTATTTTAAACTTTTTTTGTTTTTTTAAATTAATGCCAAAAAGAAAATGCATAATTTGTAAACTTAATTATAT
GTCTTATATCTTATTAGCTTAGTAGTTGGAACCACTTAGTCTTTAGGTGCAAGACTGTTGTTAGATAGTACTGAGAAAAAAAAAGTATGT

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_2708nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGC
TTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTC
TAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGG
AGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGC
AATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGT
TTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGAT
TCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTGTGG
AAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAG
AAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTG
TGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTA
AAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAG
AAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTG
AAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAG
TGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCACAA
AACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTAAAGTGACTAGAACGTTTCATTACACTGCCT
TGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTATGTAAATGTATGTGTGTATATATTAAAAAA
TGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTA
TGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCACAATACTATCTCCTGAAAGAGATAAGAGAC
ATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAAAATATTTTATGGTTTCCAAGCTTGATATCC
TTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGATTTTTGATAGCTGACATTGTGATGTTGATGT
ATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGTAAATGTTTATTGAGAACATCTTGCACACAA
TTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCC
AAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGT
ATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAGACTTAAAGGAAGAATTCTCTGAAGGGATAA

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_2738nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACA
CTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAAT
TATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTG
TTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGA
GCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGG
AAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGA
ATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTA
CCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTG
CGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGT
CTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACC
TTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCA
TTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTC
GCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATG
ACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGA
CTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTA
AAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTA
TGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGT
TAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCA
CAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAA
AATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGAT
TTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGT
AAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTT
TTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCAT
GCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAG

>In-frame_CKAP5_ENST00000312055_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_4390nt
ACTGCGGGGTGTGCGGCGGCCCAAGCGGTTTCAAACGGCTTAGAGCAGGCCGCTTGGTTCTGACCCAGCTGAGGAAATACTCTTAATTCT
AAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCGTCTGTG
CTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCC
CACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGG
CAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACT
GGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACC
TGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACA
CTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAAT
TATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTG
TTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGA
GCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGG
AAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGA
ATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTA
CCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTG
CGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGT
CTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACC
TTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCA
TTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTC
GCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATG
ACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGA
CTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTA
AAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTA
TGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGT
TAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCA
CAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAA
AATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGAT
TTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGT
AAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTT
TTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCAT
GCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAG
ACTTAAAGGAAGAATTCTCTGAAGGGATAAAGATTACTAAAAAAAAAAAAAAAAAAAAAAAATTAATGGGGTGCCTTTTTGTTATAGTTT
CTATTTTCTGTTTTGTAGGACAAGCTGCATTTTCTGTAAATATAGGTCTGGACTAAAGGATACATAAAGAATGCACAAAATGTCAACATC
AGCAGAGATGCCCAGATCTATTTATCTCTAAGTATATTTGAAGTGATTGCTGTTTATATGTTGTCATTTTAAAATTGTGTGTCAGTAAAG
CTACCTGTAAAATTTCAGTCCAAAAAAATAAAGCTCTCAGGGAGACATGAATAAAATCAATGAACATTAGAAAATAAAATATAGATGCTT
ACCATTAACCTACCAACTCTTAATATCCTTAAATTATGTGATATATAAAGAGGACTGTTACTTTTTTACTTTTTTTTTTTTTTTTTTTTT
TTTTTGGCTTTGCTTTATTTATTTGTAGTTGGGGGCTAACGTTTTCTCTTTTCTTTCTATTGATCCTGTTGTGGTTGGGTTTCCTGTGGA
GAGAGTAGTTTGTCCTGTTGCACTAGAACATTATTTACTCACTAAATTGAGTTTTTCAGTCAATTAACAAATATTTATTAAGTTCCTACT
ATGTACCAGGCATAGTAGGGCTACAATGGTAAGCAAGACAGAGTCCCTGCCCCCAAAGAGCTTATATTCTAATGGGGATATTAAGGGATG
AATAGAATACCAATGTGTGCACTGTACAGGAATCATACTATTTAAAAATAATTTGTATAAACTATAATGCTTAGCACAGATGGCGAGTTA
TCTGTGCTATGTGAAAGCTGTGAAATAGTGCTCTAAGAGTTGTCAAGAGCTGTGGTTTTACATCTTTTCCTCATTGCAAATTTAGTGACT
TTCTACACACTATATGGAAATAAATGACTAGCAAATAAAACAGTCATAAATACAAAGCAGAGGTTGCACTCCCCCAATCCCGAGTTAACC
CAGGTCTGCAATAACACCATGTTAAAGGTGCAGATAGAGACTTGGCTCAAAAAGGCTTGGAGATGAGGAAGATTGGAATATAATGATGGT
TTTGTCTGTTCCTTAACTAAAGTGCCTCTATGTATATTCTTTTCTATTTGTAGCAGGATAAATTTGGTCTGGCTCAGTTTTGGAACTGTA
TTTTGAAAATGGCTTTGTCTTACAGTTTAAGGAATAGACAGGTGGAGGGAAAGTCACATAAAGGAGCAAGTTTGTGTAGCTGTCCCTCTT
GCCCCTTTTAATCATCCTCCTTTGATATGGCCATCCTGGTGGGCCTCCTTTGCCATTTCCATTTTTGGTTTCTTTCCCTGAAAACTGTGT
GCAGGTAATTCCATGTGCCATTGTTGAAAAGAAAAAAAAAAAACAAAAAAAAAACCTACTTTTTAGATTGGTGCTGGTGTAAGTAGCCAC
TTTTCTCTCTTGGGTGTGTATTTTAAACTTTTTTTGTTTTTTTAAATTAATGCCAAAAAGAAAATGCATAATTTGTAAACTTAATTATAT
GTCTTATATCTTATTAGCTTAGTAGTTGGAACCACTTAGTCTTTAGGTGCAAGACTGTTGTTAGATAGTACTGAGAAAAAAAAAGTATGT

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000360909_chr14_59797927_+_2624nt
AATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCG
TCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCAC
CACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCT
TAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCT
TCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTG
AAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTTAAAGTTA
AAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGTTGAAATTATCCAATGACGAAATCAAACGGG
CAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACC
TATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAA
GGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGCTCAGAAG
AGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCAT
ATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTA
TTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGG
ACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATA
AGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGT
TTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTTCAAGCTG
TGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAAC
AACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAG
GAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAA
TCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGCCCTCTAAAGTGACTAGAACGTTTCATTACA
CTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACGTGTGTATGTAAATGTATGTGTGTATATATT
AAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGATTTATGTTAATGTATGTGCTCCAAAACCTTT
CGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCAGAAGCACAATACTATCTCCTGAAAGAGATA
AGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGCTTGCAAAATATTTTATGGTTTCCAAGCTTG
ATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAAAATGATTTTTGATAGCTGACATTGTGATGT
TGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACAGTCTGTAAATGTTTATTGAGAACATCTTGC
ACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATCAATTTTTTCCCCTGATTTCATCAAGTTATC
TCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCAATCCATGCTTTTTTTAAAGAACAACATTGC
CAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCACCCAAGACTTAAAGGAAGAATTCTCTGAAG

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000351081_chr14_59797927_+_2654nt
AATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCG
TCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCAC
CACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCT
TAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCT
TCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTG
AAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTG
ATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGT
TGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGA
AATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTG
AGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTA
AAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATT
ATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAA
ACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTC
AAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATC
AGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTG
AAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCT
TTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTC
GAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGT
TTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACC
AGATGACTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGC
CCTCTAAAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACG
TGTGTATGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGAT
TTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCA
GAAGCACAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGC
TTGCAAAATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAA
AATGATTTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACA
GTCTGTAAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATC
AATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCA
ATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCA

>In-frame_CKAP5_ENST00000354558_chr11_46842726_-_DAAM1_ENST00000395125_chr14_59797927_+_4306nt
AATTCTAAGGAAAACCTGGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAACTGCCAGTTGATCAGAAATGTGAACACAAGAGGGCCG
TCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCAC
CACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCT
TAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCT
TCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTG
AAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTG
ATGACACTCTGAGTTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTATCGAGGT
TGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGA
AATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTG
AGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTA
AAGTGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTTGGAAATT
ATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTAAACAAAATTGCTGACACAAAATCCAGCATCGACAAAA
ACATTACCCTTTTGCACTATCTCATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTC
AAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATC
AGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCTGATGTTG
AAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCT
TTGGCATTTTTGATCAATTTCTTCAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTC
GAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGT
TTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATTACCAACC
AGATGACTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAATTTTCCATGAATACTTTTTTTTAGAAAGCTCATTAGCAGC
CCTCTAAAGTGACTAGAACGTTTCATTACACTGCCTTGCAATCCAAACAGTGGCAATTTTTTCCTTCATCTGTGAGTGAATGTGTGAACG
TGTGTATGTAAATGTATGTGTGTATATATTAAAAAATGTATATAGATGTCTGAGTGTTGTCTGGAGACCTATACGTATGGTTAAAAAGAT
TTATGTTAATGTATGTGCTCCAAAACCTTTCGTGTATGCATTCACATTGAGTGTGGCTCATTTTCTTTCCCCGAACGCCATGACTGTTCA
GAAGCACAATACTATCTCCTGAAAGAGATAAGAGACATTCCCTAGATTCAAAGGCAAAACAGAAGAAACAAACAAACAAACAAAAAAAGC
TTGCAAAATATTTTATGGTTTCCAAGCTTGATATCCTTTAAAATTATTTTCATTGATGGAACTGGAGTTGTTGGAAAAACATAGATTTAA
AATGATTTTTGATAGCTGACATTGTGATGTTGATGTATCACATCAGTAATAGGACCAGCTTTGAATTTCTGACATTGGTGTGGGGATACA
GTCTGTAAATGTTTATTGAGAACATCTTGCACACAATTTGAATTATGTAGAATGTCAATCAAGTTTTTGTATATTTAAAAGTTGGACATC
AATTTTTTCCCCTGATTTCATCAAGTTATCTCTGCCAAGTGCTCTTGATAATTTCTTCAGATTTTTGGAAAAAAACACTATATAAATGCA
ATCCATGCTTTTTTTAAAGAACAACATTGCCAGAGTATGCTTGTTCTAACAATATAGATATATAAACCTTAAAAATAATAAAATATCTCA
CCCAAGACTTAAAGGAAGAATTCTCTGAAGGGATAAAGATTACTAAAAAAAAAAAAAAAAAAAAAAAATTAATGGGGTGCCTTTTTGTTA
TAGTTTCTATTTTCTGTTTTGTAGGACAAGCTGCATTTTCTGTAAATATAGGTCTGGACTAAAGGATACATAAAGAATGCACAAAATGTC
AACATCAGCAGAGATGCCCAGATCTATTTATCTCTAAGTATATTTGAAGTGATTGCTGTTTATATGTTGTCATTTTAAAATTGTGTGTCA
GTAAAGCTACCTGTAAAATTTCAGTCCAAAAAAATAAAGCTCTCAGGGAGACATGAATAAAATCAATGAACATTAGAAAATAAAATATAG
ATGCTTACCATTAACCTACCAACTCTTAATATCCTTAAATTATGTGATATATAAAGAGGACTGTTACTTTTTTACTTTTTTTTTTTTTTT
TTTTTTTTTTTGGCTTTGCTTTATTTATTTGTAGTTGGGGGCTAACGTTTTCTCTTTTCTTTCTATTGATCCTGTTGTGGTTGGGTTTCC
TGTGGAGAGAGTAGTTTGTCCTGTTGCACTAGAACATTATTTACTCACTAAATTGAGTTTTTCAGTCAATTAACAAATATTTATTAAGTT
CCTACTATGTACCAGGCATAGTAGGGCTACAATGGTAAGCAAGACAGAGTCCCTGCCCCCAAAGAGCTTATATTCTAATGGGGATATTAA
GGGATGAATAGAATACCAATGTGTGCACTGTACAGGAATCATACTATTTAAAAATAATTTGTATAAACTATAATGCTTAGCACAGATGGC
GAGTTATCTGTGCTATGTGAAAGCTGTGAAATAGTGCTCTAAGAGTTGTCAAGAGCTGTGGTTTTACATCTTTTCCTCATTGCAAATTTA
GTGACTTTCTACACACTATATGGAAATAAATGACTAGCAAATAAAACAGTCATAAATACAAAGCAGAGGTTGCACTCCCCCAATCCCGAG
TTAACCCAGGTCTGCAATAACACCATGTTAAAGGTGCAGATAGAGACTTGGCTCAAAAAGGCTTGGAGATGAGGAAGATTGGAATATAAT
GATGGTTTTGTCTGTTCCTTAACTAAAGTGCCTCTATGTATATTCTTTTCTATTTGTAGCAGGATAAATTTGGTCTGGCTCAGTTTTGGA
ACTGTATTTTGAAAATGGCTTTGTCTTACAGTTTAAGGAATAGACAGGTGGAGGGAAAGTCACATAAAGGAGCAAGTTTGTGTAGCTGTC
CCTCTTGCCCCTTTTAATCATCCTCCTTTGATATGGCCATCCTGGTGGGCCTCCTTTGCCATTTCCATTTTTGGTTTCTTTCCCTGAAAA
CTGTGTGCAGGTAATTCCATGTGCCATTGTTGAAAAGAAAAAAAAAAAACAAAAAAAAAACCTACTTTTTAGATTGGTGCTGGTGTAAGT
AGCCACTTTTCTCTCTTGGGTGTGTATTTTAAACTTTTTTTGTTTTTTTAAATTAATGCCAAAAAGAAAATGCATAATTTGTAAACTTAA
TTATATGTCTTATATCTTATTAGCTTAGTAGTTGGAACCACTTAGTCTTTAGGTGCAAGACTGTTGTTAGATAGTACTGAGAAAAAAAAA


Top

FusionGenePPI for CKAP5_DAAM1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CKAP5TACC1, MEPCE, CDK9, CACNA1A, CKAP5, SLAIN2, SNW1, TACC3, TACC2, PTPRN2, SIRT7, TFAP4, USP21, GRK5, TOP1, FN1, USP19, BAG3, FBXO6, SHFM1, RPA3, RPA2, RPA1, HAUS2, CCDC8, EED, AUP1, KLHL20, SPINT2, LYPD3, CYP1A1, UNK, DHX29, EIF2D, ELAC2, HARS, SRCIN1, ZNHIT2, INTS2, MAPRE1, MAPRE3, NTRK1, IFI16, BTRC, MED4, CLK1, CEP162, CEP128, CNTRL, NINL, AHSA1, ACADVL, XIAP, DHCR24, H3F3A, HSPA5, LDHA, LDHB, MAPT, PFKM, MRPS12, RPS16, RPS17, TAP2, TOP2A, ZNHIT3, AKAP1, INTS7, ACAD8, TRMT6, KLHL7, DDX31, DOT1L, PRKCDBP, CCNYL1, PTRF, FOXL1, NF2, CDC5L, NDC80, CDH1, POTEB3, ALOX5, EPHA1, TMEM206, SDC2, KLHL40, KIAA1467, HSPA8, CEP83, SNRNP27, HSPA9, BRCA1DAAM1MAP3K7, PRPF40A, B3GALT4, AMBP, RHOD, GPN3, GNAZ, TMEM185A, PIFO, RHOA, CDH1, RHOC, FBXL16, SERHL2, RANBP6, FBXL14, TUBA4A, ARMC6, TUBB, SLC37A3, CHEK2, CHEK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCKAP5chr11:46842726chr14:59797927ENST00000312055-2431932_1957191973TACC3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000354558-1421932_1957191973TACC3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000415402-2441932_1957192040TACC3
HgeneCKAP5chr11:46842726chr14:59797927ENST00000529230-2441932_1957192033TACC3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CKAP5_DAAM1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CKAP5_DAAM1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCKAP5C0002938Aneuploidy1CTD_human
HgeneCKAP5C1257806Chromosomal Instability1CTD_human