FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7145

FusionGeneSummary for CHP1_RAD51

check button Fusion gene summary
Fusion gene informationFusion gene name: CHP1_RAD51
Fusion gene ID: 7145
HgeneTgene
Gene symbol

CHP1

RAD51

Gene ID

26973

5888

Gene namecysteine and histidine rich domain containing 1RAD51 recombinase
SynonymsCHP1BRCC5|FANCR|HRAD51|HsRad51|HsT16930|MRMV2|RAD51A|RECA
Cytomap

11q14.3

15q15.1

Type of geneprotein-codingprotein-coding
Descriptioncysteine and histidine-rich domain-containing protein 1CHORD-containing protein 1CHP-1chord domain-containing protein 1cysteine and histidine-rich domain (CHORD) containing 1cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein DNA repair protein RAD51 homolog 1BRCA1/BRCA2-containing complex, subunit 5RAD51 homolog ARecA, E. coli, homolog ofRecA-like proteinrecombination protein A
Modification date2018051920180527
UniProtAcc

Q99653

Q06609

Ensembl transtripts involved in fusion geneENST00000558351, ENST00000334660, 
ENST00000560397, 
ENST00000423169, 
ENST00000267868, ENST00000557850, 
ENST00000532743, ENST00000382643, 
ENST00000530766, 
Fusion gene scores* DoF score6 X 7 X 4=1683 X 3 X 3=27
# samples 73
** MAII scorelog2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CHP1 [Title/Abstract] AND RAD51 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRAD51

GO:0000724

double-strand break repair via homologous recombination

16428451

TgeneRAD51

GO:0006268

DNA unwinding involved in DNA replication

7988572

TgeneRAD51

GO:0006974

cellular response to DNA damage stimulus

23509288|25585578

TgeneRAD51

GO:0010569

regulation of double-strand break repair via homologous recombination

23754376

TgeneRAD51

GO:0031297

replication fork processing

25585578

TgeneRAD51

GO:0051106

positive regulation of DNA ligation

8929543

TgeneRAD51

GO:0071479

cellular response to ionizing radiation

23509288|23754376

TgeneRAD51

GO:0072757

cellular response to camptothecin

23509288


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-55-8085-01ACHP1chr15

41562816

+RAD51chr15

41011003

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000558351ENST00000423169CHP1chr15

41562816

+RAD51chr15

41011003

+
3UTR-3CDSENST00000558351ENST00000267868CHP1chr15

41562816

+RAD51chr15

41011003

+
3UTR-intronENST00000558351ENST00000557850CHP1chr15

41562816

+RAD51chr15

41011003

+
3UTR-intronENST00000558351ENST00000532743CHP1chr15

41562816

+RAD51chr15

41011003

+
3UTR-intronENST00000558351ENST00000382643CHP1chr15

41562816

+RAD51chr15

41011003

+
3UTR-intronENST00000558351ENST00000530766CHP1chr15

41562816

+RAD51chr15

41011003

+
In-frameENST00000334660ENST00000423169CHP1chr15

41562816

+RAD51chr15

41011003

+
In-frameENST00000334660ENST00000267868CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000334660ENST00000557850CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000334660ENST00000532743CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000334660ENST00000382643CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000334660ENST00000530766CHP1chr15

41562816

+RAD51chr15

41011003

+
In-frameENST00000560397ENST00000423169CHP1chr15

41562816

+RAD51chr15

41011003

+
In-frameENST00000560397ENST00000267868CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000560397ENST00000557850CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000560397ENST00000532743CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000560397ENST00000382643CHP1chr15

41562816

+RAD51chr15

41011003

+
5CDS-intronENST00000560397ENST00000530766CHP1chr15

41562816

+RAD51chr15

41011003

+

Top

FusionProtFeatures for CHP1_RAD51


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CHP1

Q99653

RAD51

Q06609

Calcium-binding protein involved in different processessuch as regulation of vesicular trafficking, plasma membraneNa(+)/H(+) exchanger and gene transcription. Involved in theconstitutive exocytic membrane traffic. Mediates the associationbetween microtubules and membrane-bound organelles of theendoplasmic reticulum and Golgi apparatus and is also required forthe targeting and fusion of transcytotic vesicles (TCV) with theplasma membrane. Functions as an integral cofactor in cell pHregulation by controlling plasma membrane-type Na(+)/H(+) exchangeactivity. Affects the pH sensitivity of SLC9A1/NHE1 by increasingits sensitivity at acidic pH. Required for the stabilization andlocalization of SLC9A1/NHE1 at the plasma membrane. Inhibitsserum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role asan inhibitor of ribosomal RNA transcription by repressing thenucleolar UBF1 transcriptional activity. May sequester UBF1 in thenucleoplasm and limit its translocation to the nucleolus.Associates to the ribosomal gene promoter. Acts as a negativeregulator of the calcineurin/NFAT signaling pathway. Inhibits NFATnuclear translocation and transcriptional activity by suppressingthe calcium-dependent calcineurin phosphatase activity. Alsonegatively regulates the kinase activity of the apoptosis-inducedkinase STK17B. Inhibits both STK17B auto- and substrate-phosphorylations in a calcium-dependent manner.{ECO:0000269|PubMed:10593895, ECO:0000269|PubMed:11350981,ECO:0000269|PubMed:15035633, ECO:0000269|PubMed:8901634}. Plays an important role in homologous strand exchange, akey step in DNA repair through homologous recombination (HR)(PubMed:28575658). Binds to single and double-stranded DNA andexhibits DNA-dependent ATPase activity. Catalyzes the recognitionof homology and strand exchange between homologous DNA partners toform a joint molecule between a processed DNA break and the repairtemplate. Binds to single-stranded DNA in an ATP-dependent mannerto form nucleoprotein filaments which are essential for thehomology search and strand exchange (PubMed:26681308). Part of aPALB2-scaffolded HR complex containing BRCA2 and RAD51C and whichis thought to play a role in DNA repair by HR. Plays a role inregulating mitochondrial DNA copy number under conditions ofoxidative stress in the presence of RAD51C and XRCC3. Alsoinvolved in interstrand cross-link repair (PubMed:26253028).{ECO:0000269|PubMed:12205100, ECO:0000269|PubMed:12442171,ECO:0000269|PubMed:18417535, ECO:0000269|PubMed:20231364,ECO:0000269|PubMed:20348101, ECO:0000269|PubMed:20413593,ECO:0000269|PubMed:23509288, ECO:0000269|PubMed:23754376,ECO:0000269|PubMed:26253028, ECO:0000269|PubMed:26681308,ECO:0000269|PubMed:28575658}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CHP1_RAD51


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_273aa
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHF
RPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDN
VAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSL

>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_332aa
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHF
RPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDN
VAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAM

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_273aa
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHF
RPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDN
VAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSL

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_332aa
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHF
RPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDN
VAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_819nt
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGATTGTATCTGAGGAAAGGAAGAGGGGAAACCAGAATCTGCAAAATCTACGACTCTCCCTG

>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_996nt
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGTTTGGTGTAGCAGTGGTAATCACTAATCAGGTGGTAGCTCAAGTGGATGGAGCAGCGATG
TTTGCTGCTGATCCCAAAAAACCTATTGGAGGAAATATCATCGCCCATGCATCAACAACCAGATTGTATCTGAGGAAAGGAAGAGGGGAA
ACCAGAATCTGCAAAATCTACGACTCTCCCTGTCTTCCTGAAGCTGAAGCTATGTTCGCCATTAATGCAGATGGAGTGGGAGATGCCAAA

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_819nt
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGATTGTATCTGAGGAAAGGAAGAGGGGAAACCAGAATCTGCAAAATCTACGACTCTCCCTG

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_996nt
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGTTTGGTGTAGCAGTGGTAATCACTAATCAGGTGGTAGCTCAAGTGGATGGAGCAGCGATG
TTTGCTGCTGATCCCAAAAAACCTATTGGAGGAAATATCATCGCCCATGCATCAACAACCAGATTGTATCTGAGGAAAGGAAGAGGGGAA
ACCAGAATCTGCAAAATCTACGACTCTCCCTGTCTTCCTGAAGCTGAAGCTATGTTCGCCATTAATGCAGATGGAGTGGGAGATGCCAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_1528nt
CATTCGGGGCTGGAACTCGAACGCTGACGTTGGCTCCTGAGCCGGGCGCTGCCTCGCGCCTGATTGGCGGGTCCTCGGGGCCGCCCTCCC
CAGCGCACCACCCCTGGGTTCCCTCCCGGGTCCGCAGTGGAAACACTGCCCTCTCCCTTCTTGACCCCTAGCCCTTCCTTCCCTCCCTCC
TTCCCTCCTGTCGCCGTCTCTTCTGGCGCCGCTGCTCCCGGAGGAGCTCCCGGCACGGCGATGGGTTCTCGGGCCTCCACGTTACTGCGG
GACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGCCTCTACAGCCGGTTCACCAGCCTGGACAAA
GGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTC
TTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTCCGCCCCATTGAGGATAATGAAAAGAGCAAA
GATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGACTATATGATTTGGATAAAGATGAAAAGATC
TCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATGTACATTGACACTGAGGGTACCTTTAGGCCA
GAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAATGTAGCATATGCTCGAGCGTTCAACACAGAC
CACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTGCTTATTGTAGACAGTGCCACCGCCCTTTAC
AGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTTCTGCGGATGCTTCTGCGACTCGCTGATGAG
ATTGTATCTGAGGAAAGGAAGAGGGGAAACCAGAATCTGCAAAATCTACGACTCTCCCTGTCTTCCTGAAGCTGAAGCTATGTTCGCCAT
TAATGCAGATGGAGTGGGAGATGCCAAAGACTGAATCATTGGGTTTTTCCTCTGTTAAAAACCTTAAGTGCTGCAGCCTAATGAGAGTGC
ACTGCTCCCTGGGGTTCTCTACAGGCCTCTTCCTGTTGTGACTGCCAGGATAAAGCTTCCGGGAAAACAGCTATTATATCAGCTTTTCTG
ATGGTATAAACAGGAGACAGGTCAGTAGTCACAAACTGATCTAAAATGTTTATTCCTTCTGTAGTGTATTAATCTCTGTGTGTTTTCTTT
GGTTTTGGAGGAGGGGTATGAAGTATCTTTGACATGGTGCCTTAGGAATGACTTGGGTTTAACAAGCTGTCTACTGGACAATCTTATGTT

>In-frame_CHP1_ENST00000334660_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_2214nt
CATTCGGGGCTGGAACTCGAACGCTGACGTTGGCTCCTGAGCCGGGCGCTGCCTCGCGCCTGATTGGCGGGTCCTCGGGGCCGCCCTCCC
CAGCGCACCACCCCTGGGTTCCCTCCCGGGTCCGCAGTGGAAACACTGCCCTCTCCCTTCTTGACCCCTAGCCCTTCCTTCCCTCCCTCC
TTCCCTCCTGTCGCCGTCTCTTCTGGCGCCGCTGCTCCCGGAGGAGCTCCCGGCACGGCGATGGGTTCTCGGGCCTCCACGTTACTGCGG
GACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGCCTCTACAGCCGGTTCACCAGCCTGGACAAA
GGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTC
TTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTCCGCCCCATTGAGGATAATGAAAAGAGCAAA
GATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGACTATATGATTTGGATAAAGATGAAAAGATC
TCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATGTACATTGACACTGAGGGTACCTTTAGGCCA
GAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAATGTAGCATATGCTCGAGCGTTCAACACAGAC
CACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTGCTTATTGTAGACAGTGCCACCGCCCTTTAC
AGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTTCTGCGGATGCTTCTGCGACTCGCTGATGAG
TTTGGTGTAGCAGTGGTAATCACTAATCAGGTGGTAGCTCAAGTGGATGGAGCAGCGATGTTTGCTGCTGATCCCAAAAAACCTATTGGA
GGAAATATCATCGCCCATGCATCAACAACCAGATTGTATCTGAGGAAAGGAAGAGGGGAAACCAGAATCTGCAAAATCTACGACTCTCCC
TGTCTTCCTGAAGCTGAAGCTATGTTCGCCATTAATGCAGATGGAGTGGGAGATGCCAAAGACTGAATCATTGGGTTTTTCCTCTGTTAA
AAACCTTAAGTGCTGCAGCCTAATGAGAGTGCACTGCTCCCTGGGGTTCTCTACAGGCCTCTTCCTGTTGTGACTGCCAGGATAAAGCTT
CCGGGAAAACAGCTATTATATCAGCTTTTCTGATGGTATAAACAGGAGACAGGTCAGTAGTCACAAACTGATCTAAAATGTTTATTCCTT
CTGTAGTGTATTAATCTCTGTGTGTTTTCTTTGGTTTTGGAGGAGGGGTATGAAGTATCTTTGACATGGTGCCTTAGGAATGACTTGGGT
TTAACAAGCTGTCTACTGGACAATCTTATGTTTCCAAGAGAACTAAAGCTGGAGAGACCTGACCCTTCTCTCACTTCTAAATTAATGGTA
AAATAAAATGCCTCAGCTATGTAGCAAAGGGAATGGGTCTGCACAGATTCTTTTTTTCTGTCAGTAAAACTCTCAAGCAGGTTTTTAAGT
TGTCTGTCTGAATGATCTTGTGTAAGGTTTTGGTTATGGAGTCTTGTGCCAAACCTACTAGGCCATTAGCCCTTCACCATCTACCTGCTT
GGTCTTTCATTGCTAAGACTAACTCAAGATAATCCTAGAGTCTTAAAGCATTTCAGGCCAGTGTGGTGTCTTGCGCCTGTACTCCCAGCA
CTTTGGGAGGCCGAGGCAGGTGGATCGCTTGAGCCCAGGAGTTTTAAGTCCAGCTTGGCCAAGGTGGTGAAATCCCATCTCTACAAAAAA
TGCAGAACTTAATCTGGACACACTGTTACACGTGCCTGTAGTCCCAGCTACTCGATAGCCTGAGGTGGGAGAATCACTTAAGCCTGGAAG
GTGGAAGTTGCAGTGAGTCGAGATTGCACTGCTGCATTCCAGCCAGGGTGACAGAGTGAGACCATGTTTCAAACAAGAAACATTTCAGAG

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000423169_chr15_41011003_+_1378nt
TTGACCCCTAGCCCTTCCTTCCCTCCCTCCTTCCCTCCTGTCGCCGTCTCTTCTGGCGCCGCTGCTCCCGGAGGAGCTCCCGGCACGGCG
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGATTGTATCTGAGGAAAGGAAGAGGGGAAACCAGAATCTGCAAAATCTACGACTCTCCCTG
TCTTCCTGAAGCTGAAGCTATGTTCGCCATTAATGCAGATGGAGTGGGAGATGCCAAAGACTGAATCATTGGGTTTTTCCTCTGTTAAAA
ACCTTAAGTGCTGCAGCCTAATGAGAGTGCACTGCTCCCTGGGGTTCTCTACAGGCCTCTTCCTGTTGTGACTGCCAGGATAAAGCTTCC
GGGAAAACAGCTATTATATCAGCTTTTCTGATGGTATAAACAGGAGACAGGTCAGTAGTCACAAACTGATCTAAAATGTTTATTCCTTCT
GTAGTGTATTAATCTCTGTGTGTTTTCTTTGGTTTTGGAGGAGGGGTATGAAGTATCTTTGACATGGTGCCTTAGGAATGACTTGGGTTT
AACAAGCTGTCTACTGGACAATCTTATGTTTCCAAGAGAACTAAAGCTGGAGAGACCTGACCCTTCTCTCACTTCTAAATTAATGGTAAA

>In-frame_CHP1_ENST00000560397_chr15_41562816_+_RAD51_ENST00000267868_chr15_41011003_+_2064nt
TTGACCCCTAGCCCTTCCTTCCCTCCCTCCTTCCCTCCTGTCGCCGTCTCTTCTGGCGCCGCTGCTCCCGGAGGAGCTCCCGGCACGGCG
ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTTCCCACAGTCAAATCACTCGC
CTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAGCCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAAC
CCACTGGGGGACCGGATCATCAATGCCTTCTTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTC
CGCCCCATTGAGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTTTGCTTTTCGA
CTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGCTTCCCATTGACCGGGGTGGAGGTGAAGGAAAGGCCATG
TACATTGACACTGAGGGTACCTTTAGGCCAGAACGGCTGCTGGCAGTGGCTGAGAGGTATGGTCTCTCTGGCAGTGATGTCCTGGATAAT
GTAGCATATGCTCGAGCGTTCAACACAGACCACCAGACCCAGCTCCTTTATCAAGCATCAGCCATGATGGTAGAATCTAGGTATGCACTG
CTTATTGTAGACAGTGCCACCGCCCTTTACAGAACAGACTACTCGGGTCGAGGTGAGCTTTCAGCCAGGCAGATGCACTTGGCCAGGTTT
CTGCGGATGCTTCTGCGACTCGCTGATGAGTTTGGTGTAGCAGTGGTAATCACTAATCAGGTGGTAGCTCAAGTGGATGGAGCAGCGATG
TTTGCTGCTGATCCCAAAAAACCTATTGGAGGAAATATCATCGCCCATGCATCAACAACCAGATTGTATCTGAGGAAAGGAAGAGGGGAA
ACCAGAATCTGCAAAATCTACGACTCTCCCTGTCTTCCTGAAGCTGAAGCTATGTTCGCCATTAATGCAGATGGAGTGGGAGATGCCAAA
GACTGAATCATTGGGTTTTTCCTCTGTTAAAAACCTTAAGTGCTGCAGCCTAATGAGAGTGCACTGCTCCCTGGGGTTCTCTACAGGCCT
CTTCCTGTTGTGACTGCCAGGATAAAGCTTCCGGGAAAACAGCTATTATATCAGCTTTTCTGATGGTATAAACAGGAGACAGGTCAGTAG
TCACAAACTGATCTAAAATGTTTATTCCTTCTGTAGTGTATTAATCTCTGTGTGTTTTCTTTGGTTTTGGAGGAGGGGTATGAAGTATCT
TTGACATGGTGCCTTAGGAATGACTTGGGTTTAACAAGCTGTCTACTGGACAATCTTATGTTTCCAAGAGAACTAAAGCTGGAGAGACCT
GACCCTTCTCTCACTTCTAAATTAATGGTAAAATAAAATGCCTCAGCTATGTAGCAAAGGGAATGGGTCTGCACAGATTCTTTTTTTCTG
TCAGTAAAACTCTCAAGCAGGTTTTTAAGTTGTCTGTCTGAATGATCTTGTGTAAGGTTTTGGTTATGGAGTCTTGTGCCAAACCTACTA
GGCCATTAGCCCTTCACCATCTACCTGCTTGGTCTTTCATTGCTAAGACTAACTCAAGATAATCCTAGAGTCTTAAAGCATTTCAGGCCA
GTGTGGTGTCTTGCGCCTGTACTCCCAGCACTTTGGGAGGCCGAGGCAGGTGGATCGCTTGAGCCCAGGAGTTTTAAGTCCAGCTTGGCC
AAGGTGGTGAAATCCCATCTCTACAAAAAATGCAGAACTTAATCTGGACACACTGTTACACGTGCCTGTAGTCCCAGCTACTCGATAGCC
TGAGGTGGGAGAATCACTTAAGCCTGGAAGGTGGAAGTTGCAGTGAGTCGAGATTGCACTGCTGCATTCCAGCCAGGGTGACAGAGTGAG


Top

FusionGenePPI for CHP1_RAD51


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CHP1SLC9A1, SLC9A2, SLC9A3, SLC9A4, SLC9A5, PRSS23, ELAVL1, SHMT2, MOV10, NXF1, TMEM216, XPO1, DUSP22, DUSP6, UBCRAD51BRCA2, RAD51AP1, DMC1, EIF2D, CAB39, TIMM13, H2AFX, BRCA1, BARD1, BRE, BRCC3, TP53, ABL1, RAD52, BLM, RAD51, RAD51B, RAD51C, RAD51D, XRCC2, XRCC3, ATM, VIM, CHD3, RAD54B, ATRX, DNAJA3, SUMO1, UBE2I, RPA1, MSH4, RAD18, MCPH1, SP1, MDC1, PALB2, MORF4L1, POLN, WRN, UHRF2, MSH2, MSH6, TERF2IP, PML, SWI5, SFR1, RECQL5, CHEK1, SWSAP1, AICDA, RPA3, PFN1, FBXO18, UGDH, NXF1, HNRNPA2B1, HNRNPC, ZDHHC17, TEAD1, PDS5B, CDH13, CST6, FAM84B, IL24, ITIH5, NAT2, ST14, TFF1, WHSC1L1, NELFB, CSNK2B, HSP90AA1, MAPK8IP3, PCSK1N, SIRT2, UMPS, USP10, CDC42, IGBP1, MYH11, PPP3CB, RAB5C, LRP8, CBX4, SLC33A1, HMG20A, RNASEH2A, TUBGCP2, POLK, RTEL1, KIF21A, UGGT1, CDC73, CXXC4, ELMSAN1, NAF1, SGOL1, HMGXB4, CASP3, TUBG1, ESR1, FANCD2, PCNA, ERCC5, SHFM1, UCHL3, DUSP21, FIGNL1, SNX32, DNA2, HSFY1, PARPBP, TUBA1A, LMNB1, FANCA, SPTA1, WDR48, KEAP1, BCR, RFWD3, USP21, RNF115


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CHP1_RAD51


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCHP1Q99653DB11093Calcium CitrateCalcineurin B homologous protein 1small moleculeapproved
HgeneCHP1Q99653DB11348Calcium PhosphateCalcineurin B homologous protein 1small moleculeapproved

Top

RelatedDiseases for CHP1_RAD51


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRAD51C0006142Malignant neoplasm of breast1UNIPROT
TgeneRAD51C0018671Head and Neck Neoplasms1CTD_human
TgeneRAD51C1449861Micronuclei, Chromosome-Defective1CTD_human