FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7123

FusionGeneSummary for CHMP5_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: CHMP5_VMP1
Fusion gene ID: 7123
HgeneTgene
Gene symbol

CHMP5

VMP1

Gene ID

51510

81671

Gene namecharged multivesicular body protein 5vacuole membrane protein 1
SynonymsC9orf83|CGI-34|HSPC177|PNAS-2|SNF7DC2|Vps60EPG3|TANGO5|TMEM49
Cytomap

9p13.3

17q23.1

Type of geneprotein-codingprotein-coding
Descriptioncharged multivesicular body protein 5SNF7 domain containing 2SNF7 domain-containing protein 2apoptosis-related protein PNAS-2chromatin-modifying protein 5hVps60vacuolar protein sorting-associated protein 60vacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018052220180523
UniProtAcc

Q9NZZ3

Q96GC9

Ensembl transtripts involved in fusion geneENST00000223500, ENST00000419016, 
ENST00000487080, 
ENST00000262291, 
ENST00000537567, ENST00000539763, 
ENST00000536180, ENST00000545362, 
ENST00000588617, 
Fusion gene scores* DoF score3 X 2 X 2=1224 X 11 X 12=3168
# samples 327
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CHMP5 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A15H-01ACHMP5chr9

33266112

+VMP1chr17

57886157

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000223500ENST00000262291CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000223500ENST00000537567CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000223500ENST00000539763CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000223500ENST00000536180CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000223500ENST00000545362CHMP5chr9

33266112

+VMP1chr17

57886157

+
5CDS-intronENST00000223500ENST00000588617CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000419016ENST00000262291CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000419016ENST00000537567CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000419016ENST00000539763CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000419016ENST00000536180CHMP5chr9

33266112

+VMP1chr17

57886157

+
In-frameENST00000419016ENST00000545362CHMP5chr9

33266112

+VMP1chr17

57886157

+
5CDS-intronENST00000419016ENST00000588617CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-3CDSENST00000487080ENST00000262291CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-3CDSENST00000487080ENST00000537567CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-3CDSENST00000487080ENST00000539763CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-3CDSENST00000487080ENST00000536180CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-3CDSENST00000487080ENST00000545362CHMP5chr9

33266112

+VMP1chr17

57886157

+
intron-intronENST00000487080ENST00000588617CHMP5chr9

33266112

+VMP1chr17

57886157

+

Top

FusionProtFeatures for CHMP5_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CHMP5

Q9NZZ3

VMP1

Q96GC9

Probable peripherally associated component of theendosomal sorting required for transport complex III (ESCRT-III)which is involved in multivesicular bodies (MVBs) formation andsorting of endosomal cargo proteins into MVBs. MVBs containintraluminal vesicles (ILVs) that are generated by invaginationand scission from the limiting membrane of the endosome and mostlyare delivered to lysosomes enabling degradation of membraneproteins, such as stimulated growth factor receptors, lysosomalenzymes and lipids. The MVB pathway appears to require thesequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membranebefore the ILV is released. The ESCRT machinery also functions intopologically equivalent membrane fission events, such as theterminal stages of cytokinesis and the budding of envelopedviruses (HIV-1 and other lentiviruses). ESCRT-III proteins arebelieved to mediate the necessary vesicle extrusion and/ormembrane fission activities, possibly in conjunction with the AAAATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.{ECO:0000269|PubMed:14519844}. Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612272_273238407Topological domainCytoplasmic
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612295_305238407Topological domainExtracellular
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612327_363238407Topological domainCytoplasmic
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612385_406238407Topological domainExtracellular
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612251_271238407TransmembraneHelical
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612274_294238407TransmembraneHelical
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612306_326238407TransmembraneHelical
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612364_384238407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCHMP5chr9:33266112chr17:57886157ENST00000223500+2826_17958220Coiled coilOntology_term=ECO:0000255
HgeneCHMP5chr9:33266112chr17:57886157ENST00000419016+2726_17958172Coiled coilOntology_term=ECO:0000255
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612131_250238407Topological domainExtracellular
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+6122_43238407Topological domainCytoplasmic
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+61265_77238407Topological domainExtracellular
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+61299_109238407Topological domainCytoplasmic
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+612110_130238407TransmembraneHelical
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+61244_64238407TransmembraneHelical
TgeneVMP1chr9:33266112chr17:57886157ENST00000262291+61278_98238407TransmembraneHelical


Top

FusionGeneSequence for CHMP5_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_227aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKTKDQIKKMREGPAKDFASRAKLAVQKLVQKVGFFGILACASIPNPL
FDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_681nt
ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCC
ATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTT
GCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTA
TTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAA
ATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATA
GGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGA
GAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_1999nt
AATCCGGAAAAAGAATCGGGAAACGCCAGGAGGCATATTGCGCTTGCGCACGGAGGGGCCGGAAGTCGAGGCGGGAGTGACTCTGCTTCC
GTTTCTGGTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGC
CCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGT
ATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAG
TTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTT
TTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGC
ACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTC
AACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCA
TGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAA
CTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAAT
TCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTG
CTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGG
CCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTC
AAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCA
TGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACAC
CCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCT
GTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTT
TTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAG
AGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTT
CTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCAC
ACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTC
TGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAA

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_1078nt
AATCCGGAAAAAGAATCGGGAAACGCCAGGAGGCATATTGCGCTTGCGCACGGAGGGGCCGGAAGTCGAGGCGGGAGTGACTCTGCTTCC
GTTTCTGGTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGC
CCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGT
ATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAG
TTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTT
TTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGC
ACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTC
AACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCA
TGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAA
CTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAAT
TCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_1038nt
AATCCGGAAAAAGAATCGGGAAACGCCAGGAGGCATATTGCGCTTGCGCACGGAGGGGCCGGAAGTCGAGGCGGGAGTGACTCTGCTTCC
GTTTCTGGTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGC
CCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGT
ATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAG
TTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTT
TTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGC
ACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTC
AACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCA
TGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAA
CTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAAT
TCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTG

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_910nt
AATCCGGAAAAAGAATCGGGAAACGCCAGGAGGCATATTGCGCTTGCGCACGGAGGGGCCGGAAGTCGAGGCGGGAGTGACTCTGCTTCC
GTTTCTGGTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGC
CCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGT
ATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAG
TTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTT
TTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGC
ACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTC
AACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCA
TGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAA
CTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAAT

>In-frame_CHMP5_ENST00000223500_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_1070nt
AATCCGGAAAAAGAATCGGGAAACGCCAGGAGGCATATTGCGCTTGCGCACGGAGGGGCCGGAAGTCGAGGCGGGAGTGACTCTGCTTCC
GTTTCTGGTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGC
CCAGCCTGACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGT
ATAAGGATCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAG
TTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTT
TTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGC
ACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTC
AACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCA
TGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAA
CTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAAT
TCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTG

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000262291_chr17_57886157_+_1902nt
GTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCT
GACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATT
TTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGAC
CTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGT
GGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCA
GAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTG
TTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATA
AGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTT
TCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGT
AAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTG
TTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTT
TTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTAT
CATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGG
GGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATT
TAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTT
TTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACT
ACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTT
TGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGT
CGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGT
GTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAACAATTTT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000537567_chr17_57886157_+_981nt
GTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCT
GACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATT
TTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGAC
CTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGT
GGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCA
GAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTG
TTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATA
AGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTT
TCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000539763_chr17_57886157_+_941nt
GTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCT
GACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATT
TTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGAC
CTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGT
GGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCA
GAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTG
TTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATA
AGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTT
TCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000536180_chr17_57886157_+_813nt
GTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCT
GACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATT
TTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGAC
CTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGT
GGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCA
GAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTG
TTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATA
AGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTT

>In-frame_CHMP5_ENST00000419016_chr9_33266112_+_VMP1_ENST00000545362_chr17_57886157_+_973nt
GTTTTGCTCTAGTGTTTGGGTTTCTTCGCGGCTGCTCAAGATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCT
GACTGACTGCATTGGCACGGTGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATT
TTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGAC
CTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGT
GGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCA
GAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTG
TTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATA
AGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTT
TCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGT


Top

FusionGenePPI for CHMP5_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CHMP5APPBP2, CAMK2A, VTA1, VPS4A, ISG15, CHMP1B, CHMP4A, CHMP4B, CHMP5, ZNF91, RPL38, PDCD10, GTF3A, ZNF142, URGCP, SMARCA4, ATP6V1B1, UBA2, STAMBP, SNCA, PXN, VPS4B, MITD1, UNK, ACTR6, HABP4, PSMA4, SNRPD2, HIST1H2BG, EWSR1, HNRNPD, AURKA, TFG, SGTB, BAG6, TSG101, RAB5A, RAB7A, CDH1, TCP10L, STMN4, CHMP1A, CHMP3, SH3KBP1, CHMP2AVMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCHMP5chr9:33266112chr17:57886157ENST00000223500+28121_15858220VTA1
HgeneCHMP5chr9:33266112chr17:57886157ENST00000419016+27121_15858172VTA1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CHMP5_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CHMP5_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCHMP5C0023467Leukemia, Myelocytic, Acute1CTD_human