FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7021

FusionGeneSummary for CHD7_TCF7L2

check button Fusion gene summary
Fusion gene informationFusion gene name: CHD7_TCF7L2
Fusion gene ID: 7021
HgeneTgene
Gene symbol

CHD7

TCF7L2

Gene ID

55636

6934

Gene namechromodomain helicase DNA binding protein 7transcription factor 7 like 2
SynonymsCRG|HH5|IS3|KAL5TCF-4|TCF4
Cytomap

8q12.2

10q25.2-q25.3

Type of geneprotein-codingprotein-coding
Descriptionchromodomain-helicase-DNA-binding protein 7ATP-dependent helicase CHD7CHARGE associationchromodomain helicase DNA binding protein 7 isoform CRA_etranscription factor 7-like 2HMG box transcription factor 4T-cell factor 4T-cell-specific transcription factor 4hTCF-4transcription factor 7-like 2 (T-cell specific, HMG-box)
Modification date2018051920180527
UniProtAcc

Q9P2D1

Q9NQB0

Ensembl transtripts involved in fusion geneENST00000423902, ENST00000524602, 
ENST00000525508, ENST00000529472, 
ENST00000534894, ENST00000536810, 
ENST00000545257, ENST00000355995, 
ENST00000543371, ENST00000355717, 
ENST00000538897, ENST00000349937, 
ENST00000369397, ENST00000352065, 
ENST00000369395, ENST00000542695, 
ENST00000369389, ENST00000369386, 
ENST00000466338, 
Fusion gene scores* DoF score10 X 6 X 6=3605 X 3 X 6=90
# samples 1210
** MAII scorelog2(12/360*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/90*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CHD7 [Title/Abstract] AND TCF7L2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTCF7L2

GO:0000122

negative regulation of transcription by RNA polymerase II

12799378

TgeneTCF7L2

GO:0006357

regulation of transcription by RNA polymerase II

9727977

TgeneTCF7L2

GO:0032092

positive regulation of protein binding

12799378

TgeneTCF7L2

GO:0032350

regulation of hormone metabolic process

15525634

TgeneTCF7L2

GO:0042593

glucose homeostasis

15525634

TgeneTCF7L2

GO:0043433

negative regulation of DNA binding transcription factor activity

12799378

TgeneTCF7L2

GO:0045444

fat cell differentiation

10937998

TgeneTCF7L2

GO:0045892

negative regulation of transcription, DNA-templated

12799378|15525634

TgeneTCF7L2

GO:0045944

positive regulation of transcription by RNA polymerase II

9065401|19168596

TgeneTCF7L2

GO:0048625

myoblast fate commitment

10937998


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-F4-6807-01ACHD7chr8

61655656

+TCF7L2chr10

114900943

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000423902ENST00000534894CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000536810CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000545257CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000355995CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000543371CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000355717CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000538897CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000349937CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000369397CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000352065CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000423902ENST00000369395CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-5UTRENST00000423902ENST00000542695CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000423902ENST00000369389CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000423902ENST00000369386CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000423902ENST00000466338CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000534894CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000536810CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000545257CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000355995CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000543371CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000355717CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000538897CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000349937CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000369397CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000352065CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000524602ENST00000369395CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-5UTRENST00000524602ENST00000542695CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000524602ENST00000369389CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000524602ENST00000369386CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000524602ENST00000466338CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000534894CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000536810CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000545257CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000355995CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000543371CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000355717CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000538897CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000349937CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000369397CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000352065CHD7chr8

61655656

+TCF7L2chr10

114900943

+
In-frameENST00000525508ENST00000369395CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-5UTRENST00000525508ENST00000542695CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000525508ENST00000369389CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000525508ENST00000369386CHD7chr8

61655656

+TCF7L2chr10

114900943

+
5CDS-intronENST00000525508ENST00000466338CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000534894CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000536810CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000545257CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000355995CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000543371CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000355717CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000538897CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000349937CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000369397CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000352065CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-3CDSENST00000529472ENST00000369395CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-5UTRENST00000529472ENST00000542695CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-intronENST00000529472ENST00000369389CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-intronENST00000529472ENST00000369386CHD7chr8

61655656

+TCF7L2chr10

114900943

+
intron-intronENST00000529472ENST00000466338CHD7chr8

61655656

+TCF7L2chr10

114900943

+

Top

FusionProtFeatures for CHD7_TCF7L2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CHD7

Q9P2D1

TCF7L2

Q9NQB0


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238151_2225552998Compositional biasNote=Gln-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15151_222555949Compositional biasNote=Gln-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112151_2225551139Compositional biasNote=Gln-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000352065+315178_317161386Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000369397+314178_317161597Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000352065+315350_418161386DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355717+413350_418208490DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355995+415350_418184620DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000369397+314350_418161597DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000534894+415350_418184495DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000536810+414350_418184603DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000538897+414350_418184483DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000543371+414350_418184603DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000545257+415350_418184620DNA bindingHMG box
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000352065+315425_430161386MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355717+413425_430208490MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355995+415425_430184620MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000369397+314425_430161597MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000534894+415425_430184495MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000536810+414425_430184603MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000538897+414425_430184483MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000543371+414425_430184603MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000545257+415425_430184620MotifNuclear localization signal
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000352065+315459_505161386RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355717+413459_505208490RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355995+415459_505184620RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000369397+314459_505161597RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000534894+415459_505184495RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000536810+414459_505184603RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000538897+414459_505184483RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000543371+414459_505184603RegionNote=Promoter-specific activation domain
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000545257+415459_505184620RegionNote=Promoter-specific activation domain

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2382401_24315552998Coiled coilOntology_term=ECO:0000255
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+152401_2431555949Coiled coilOntology_term=ECO:0000255
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1122401_24315551139Coiled coilOntology_term=ECO:0000255
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2381939_19455552998Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2382165_22585552998Compositional biasNote=Glu-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2382398_24055552998Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2382726_27365552998Compositional biasNote=Poly-Ala
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238383_5685552998Compositional biasNote=Pro-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238597_7185552998Compositional biasNote=Lys-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+151939_1945555949Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+152165_2258555949Compositional biasNote=Glu-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+152398_2405555949Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+152726_2736555949Compositional biasNote=Poly-Ala
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15383_568555949Compositional biasNote=Pro-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15597_718555949Compositional biasNote=Lys-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1121939_19455551139Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1122165_22585551139Compositional biasNote=Glu-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1122398_24055551139Compositional biasNote=Poly-Arg
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1122726_27365551139Compositional biasNote=Poly-Ala
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112383_5685551139Compositional biasNote=Pro-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112597_7185551139Compositional biasNote=Lys-rich
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2381294_14645552998DomainHelicase C-terminal
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238800_8675552998DomainChromo 1
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238882_9475552998DomainChromo 2
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238980_11545552998DomainHelicase ATP-binding
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+151294_1464555949DomainHelicase C-terminal
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15800_867555949DomainChromo 1
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15882_947555949DomainChromo 2
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15980_1154555949DomainHelicase ATP-binding
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1121294_14645551139DomainHelicase C-terminal
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112800_8675551139DomainChromo 1
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112882_9475551139DomainChromo 2
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112980_11545551139DomainHelicase ATP-binding
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+2381105_11085552998MotifNote=DEAH box
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+151105_1108555949MotifNote=DEAH box
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+1121105_11085551139MotifNote=DEAH box
HgeneCHD7chr8:61655656chr10:114900943ENST00000423902+238993_10005552998Nucleotide bindingATP
HgeneCHD7chr8:61655656chr10:114900943ENST00000524602+15993_1000555949Nucleotide bindingATP
HgeneCHD7chr8:61655656chr10:114900943ENST00000525508+112993_10005551139Nucleotide bindingATP
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355717+413178_317208490Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355995+415178_317184620Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000534894+415178_317184495Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000536810+414178_317184603Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000538897+414178_317184483Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000543371+414178_317184603Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000545257+415178_317184620Compositional biasNote=Pro-rich
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000352065+3151_53161386RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355717+4131_53208490RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000355995+4151_53184620RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000369397+3141_53161597RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000534894+4151_53184495RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000536810+4141_53184603RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000538897+4141_53184483RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000543371+4141_53184603RegionCTNNB1-binding
TgeneTCF7L2chr8:61655656chr10:114900943ENST00000545257+4151_53184620RegionCTNNB1-binding


Top

FusionGeneSequence for CHD7_TCF7L2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_866aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_837aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_660aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_664aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_866aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_837aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_660aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_664aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_866aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_974aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
DANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHL

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_837aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_660aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_991aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN
EHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTE
QTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_854aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW
LVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPH
IKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETN

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_664aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMM
SNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVA
HSPRFSPNPPQQGAVRPQTLNFSSRSQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGIPMEVGSYPNMPHPQPSHQPPGAMGIGQRNM
GPRNMQQSRPFIGMSSAPRELTGHMRPNGCPGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_2598nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGG
CTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_2511nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_1980nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
CAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTGA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_1992nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_2598nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGG
CTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_2511nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_1980nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
CAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTGA

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_1992nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_2598nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGG
CTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_2922nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_2511nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_1980nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
CAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTGA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_2973nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_2562nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_1992nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_3077nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCG
CTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGATGCAAATACTCCAAAGAAGTGTCGG

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_5107nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGT
GCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTAC
TAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCC
TCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCT
TACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCC
GCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGT
GCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGA
TGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAA
CTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGG
AGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCA
GTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTA
AAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGG
GCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATA
AAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATA
TTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGC
ATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGG
GAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGT
GCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGA
TTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTT
AAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAG
ACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGAC
ATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCT
AACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTT

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_5158nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATA
CTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACA
TACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCC
CTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGC
CTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTT
TGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGC
CGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTT
GCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATT
GGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCA
ACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGA
TTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCG
AACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAAC
TCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTT
TTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTAC
CTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAA
CAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGA
AACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAA
GACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATG
CCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTT
GATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGT
TTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGA
AAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGC
AAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGT
TTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATT
CCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_5158nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCG
CTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACA
TACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCC
CTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGC
CTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTT
TGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGC
CGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTT
GCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATT
GGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCA
ACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGA
TTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCG
AACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAAC
TCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTT
TTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTAC
CTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAA
CAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGA
AACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAA
GACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATG
CCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTT
GATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGT
TTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGA
AAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGC
AAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGT
TTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATT
CCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_5107nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGT
GCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTAC
TAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCC
TCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCT
TACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCC
GCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGT
GCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGA
TGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAA
CTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGG
AGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCA
GTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTA
AAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGG
GCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATA
AAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATA
TTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGC
ATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGG
GAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGT
GCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGA
TTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTT
AAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAG
ACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGAC
ATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCT
AACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTT

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_5034nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTC
TTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGAC
CCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCAC
CCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACA
GCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCT
TTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTG
TACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCT
CCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAA
TATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGA
AGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTA
AGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATG
TACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAG
AATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTT
TTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATA
TAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTG
CATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACAC
TGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCG
TGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGT
GATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATG
AAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTAC
ATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCA
GTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAA
TACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTT

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_5085nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAA
AAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCC
GAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGC
CCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGA
CCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGC
CGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGT
TTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGA
TGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTC
TACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCT
TAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTA
TTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTT
TTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGT
TCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTA
GAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCAT
AAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACT
TTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAA
GCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTT
GAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTA
GCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCA
CCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATT
AGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCT
AGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTC
TCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTC
CGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_2461nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTC

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_5158nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCG
CTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACA
TACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCC
CTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGC
CTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTT
TGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGC
CGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTT
GCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATT
GGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCA
ACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGA
TTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCG
AACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAAC
TCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTT
TTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTAC
CTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAA
CAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGA
AACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAA
GACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATG
CCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTT
GATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGT
TTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGA
AAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGC
AAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGT
TTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATT
CCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAA

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_3117nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT
ACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTC
CGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCA
AAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAG
CTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACT
ACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGA
AAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCG
CTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGTCTTTGAATTTGGAATATTACAATGG

>In-frame_CHD7_ENST00000423902_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_2473nt
CGGCGGCGGCGGCAGCGGCGGCGGCGGCGGCGGCGCGGGGGTTGAGTCGTGGTGGTGCGGACGCGCTCGTGCTCGGGAACTATCGGATTA
AACTTGAATCGAGTGAAATTACACAAAGGAGCGCCGCGGAGGAGGCGGCCCGGGGACCCGGACACCCTGAAACTCACCAGAGACCCGTTC
GCCCCCGGCCAACTCCGTGCCCGTGGATTCAGCCCCCTGGCCGCAGCTGCCGAGCCAACTCCGGAGCCCGCTCTGCGTTTTGTTTTCCCC
TCGGCACTAGGCAGCGGAGGAGCCCGACCGACCCGGACCTATATCCAGACTTTGCCTGACACTGCAGGGTCCAAGAGAATTAAAGAAATA
TGGAATGACATGAAGAAGATTAGTTAAGGATTATAGGCTTTGAGGGCAAACACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGT
GGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTC
TTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTAC
AGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGC
ATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTC
CTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACA
GCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGC
AGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGC
AGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAG
GACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCT
CTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTA
ACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGG
GATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTG
TAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTA
TGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTC
CACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTG
GTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAAT
TGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAAC
ATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCAC
ACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAG
TGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACT
TACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCG
TAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_2666nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_4696nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGACCTGAGCGCTCCTAAGAAAT
GCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG
GCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACG
CCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCG
CCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCG
CCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCG
TCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCC
CACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTG
ACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAA
AGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAA
AAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTT
TACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGAT
GTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGG
GACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTC
CCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGT
ACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTC
ACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATG
AGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCG
CCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATT
TTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGAT
TGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGC
CGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTAT
AAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGC
TAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTT
TTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAATAAAAGCAACTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_4747nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGT
GCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTAC
TAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCC
TCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCT
TACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCC
GCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGT
GCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGA
TGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAA
CTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGG
AGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCA
GTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTA
AAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGG
GCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATA
AAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATA
TTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGC
ATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGG
GAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGT
GCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGA
TTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTT
AAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAG
ACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGAC
ATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCT
AACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_4747nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGT
GCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTAC
TAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCC
TCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCT
TACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCC
GCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGT
GCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGA
TGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAA
CTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGG
AGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCA
GTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTA
AAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGG
GCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATA
AAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATA
TTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGC
ATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGG
GAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGT
GCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGA
TTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTT
AAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAG
ACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGAC
ATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCT
AACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_4696nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGATGCAAATACTCCAAAGAAGT
GTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG
GCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACG
CCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCG
CCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCG
CCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCG
TCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCC
CACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTG
ACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAA
AGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAA
AAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTT
TACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGAT
GTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGG
GACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTC
CCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGT
ACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTC
ACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATG
AGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCG
CCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATT
TTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGAT
TGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGC
CGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTAT
AAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGC
TAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTT
TTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAATAAAAGCAACTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_4623nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGGAGAAAAAAAAAGTGCGTTCG
CTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGG
CTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCAT
GATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGC
CGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCC
CCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTT
AATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGT
TCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTT
TATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAG
ACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGC
TTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAA
ACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTG
TTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGT
CGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATA
TATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTG
TATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAA
AACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTG
GGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTC
TTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAA
TGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTA
AACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGAT
GTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCT
CTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTC
TTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGG

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_4674nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTC
TTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGAC
CCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCAC
CCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACA
GCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCT
TTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTG
TACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCT
CCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAA
TATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGA
AGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTA
AGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATG
TACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAG
AATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTT
TTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATA
TAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTG
CATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACAC
TGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCG
TGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGT
GATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATG
AAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTAC
ATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCA
GTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAA
TACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_2050nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGCAAGGTCAACCAGTGTACCCAA

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_4747nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGT
GCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTAC
TAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGT
CCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCC
TCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCT
TACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCC
GCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGT
GCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGA
TGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAA
CTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGG
AGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCA
GTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTA
AAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGG
GCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATA
AAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATA
TTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGC
ATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGG
GAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGT
GCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGA
TTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTT
AAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAG
ACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGAC
ATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCT
AACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTT

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_2706nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC
CAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATA
TGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTG
ATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCTTAATGCAT
TCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCCATCAACCAGATCCTTGGGCGGA
GGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCT
GGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAA
ATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGT
GCGGCCCTTGCAGTCTTTGAATTTGGAATATTACAATGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGC

>In-frame_CHD7_ENST00000524602_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_2062nt
ACCTCAGTGAAGTGAAGCACAGGCAAGCTCCTGAGCTGTGGTTTGGAGGAGCCGTGTGTTGGAAGAAGATGGCAGATCCAGGAATGATGA
GTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCGGAAAATCCAGTAAATCCTATGG
GTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAATCAAAATCAAACAAAGCTGACAC
ATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATGAGCAACACCCCTGGGAACGGAC
TCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGCGGTCAGATGGGTGTCTACCCTG
GCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTTCAGGTACCAGACCAGATACGAG
CCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAGGGCCACCCTCAGCACATGCAGC
AGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATGAGCCAGTTTTCCCAAGGCCAAG
AGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAGCAGAGTCCCAGCATGGCACCTT
CCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCGA
ATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCCTCTCCTACTATAAACAACTCAG
GGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAAAATTTAGGCCTTACAAATAATA
CTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGACTAATGCACCAGCAGCCCATCC
ACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTATGCCTCTCCACCTCCCATGTCAC
CCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATACCAATGGAAGTTGGCAGTTATC
CAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATGGGCCCCAGAAACATGCAGCAGT
CTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGTCCTGGTGTTGGCCTTGGAGACC
CACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAGTTGCCAACCTGTCCTCCACTGC
AGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTCCACCCATCACCCCAGAACACCC
CGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACA
GCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCTCCGCACCCTC
CAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGGTTAGTACCACAGCAAGGTCAAC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000534894_chr10_114900943_+_2598nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000536810_chr10_114900943_+_4628nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC
CAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTT
TTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTAT
CGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAA
ATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTT
AAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATA
CGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGT
GTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGG
TGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTG
CTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATC
TTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTT
TTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTA
TGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCC
CAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCT
CCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAA
CAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTAC
TCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATG
TTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATT
TTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTA
TGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGT

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000545257_chr10_114900943_+_4679nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGG
CTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA
TAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTG
TTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAA
TTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTA
AAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAAT
TTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAA
CCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTT
AAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTT
AATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTT
TCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTT
ATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAAT
AGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGC
GACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACT
GACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTT
GCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTT
AAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACAT
ATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTC
ATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTT
GTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355995_chr10_114900943_+_4679nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA
TAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTG
TTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAA
TTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTA
AAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAAT
TTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAA
CCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTT
AAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTT
AATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTT
TCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTT
ATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAAT
AGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGC
GACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACT
GACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTT
GCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTT
AAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACAT
ATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTC
ATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTT
GTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000543371_chr10_114900943_+_4628nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GATGCAAATACTCCAAAGAAGTGTCGGGCACTGTTCGGGCTTGACCGACAGACTTTATGGTGCAAACCGTGCAGGAGAAAAAAAAAGTGC
GTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTG
CTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTG
TCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCC
CCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACC
CAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTT
TTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTAT
CGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAA
ATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTT
AAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATA
CGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGT
GTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGG
TGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTG
CTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATC
TTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTT
TTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTA
TGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCC
CAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCT
CCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAA
CAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTAC
TCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATG
TTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATT
TTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTA
TGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGT

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000355717_chr10_114900943_+_4555nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTC
CCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCG
ACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACG
GGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACA
GCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTT
ATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTA
CATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAAC
CTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGT
TCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGT
ATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTT
TTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAA
TATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATT
TATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCC
CCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCC
CTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGT
TGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCG
TTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTC
AGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGT
TTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAAT
TCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATA
AAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTG
TAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGAT
GTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAG

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000538897_chr10_114900943_+_4606nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAG
GCAGCTGCCTCAGCCCACCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACG
CCAAGTCACAGACTGAGCAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCG
CCCTCCTGCTCGCTGAGGCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCG
CCCCCTCCTCATCAATTGCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCG
TCACCAAGTCTTTAGAATAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCC
CACCTTGAAAGGTTTTGTTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTG
ACCCATTCTTATTTCAATTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAA
AGTCTTTGTAGCGTTTAAAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAA
AAGAAAAAAAAAGCAATTTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTT
TACATCTGGTTTTTAAACCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGAT
GTTACTTGTTATTGTTTAAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGG
GACGCTACTCAACACTTAATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTC
CCTTTTTAAATATGTTTTCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGT
ACAAGGTTTTTAAGTTTATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTC
ACCAAATGGACATTAATAGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATG
AGTGAGGGAATTTTAGCGACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCG
CCCTTAGGACCCGGACTGACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATT
TTTGTTCATCATGTTTTGCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGAT
TGTCCAGAAAGCATTTTAAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGC
CGCTTTTATGTACACATATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTAT
AAAGCTGAAACCTGTTCATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGC
TAACTATAACATTTTTTGTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTT
TTAATGGTTTGGAAGCCATTTTTGTAATGAATAAATGTTCATGCTGTACAGTATCTGTAGCATGCCGTTCTGGATTAATAAAAGCAACTT

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000349937_chr10_114900943_+_1982nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
CAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCCATGTCCAGGTGA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369397_chr10_114900943_+_4679nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGGAGAAAAAAAAAGTGCGTTCGCTACATACAAGGTGAAGGCAGCTGCCTCAGCCCA
CCCTCTTCAGATGGAAGCTTACTAGATTCGCCTCCCCCCTCCCCGAACCTGCTAGGCTCCCCTCCCCGAGACGCCAAGTCACAGACTGAG
CAGACCCAGCCTCTGTCGCTGTCCCTGAAGCCCGACCCCCTGGCCCACCTGTCCATGATGCCTCCGCCACCCGCCCTCCTGCTCGCTGAG
GCCACCCACAAGGCCTCCGCCCTCTGTCCCAACGGGGCCCTGGACCTGCCCCCAGCCGCTTTGCAGCCTGCCGCCCCCTCCTCATCAATT
GCACAGCCGTCGACTTCTTCCTTACATTCCCACAGCTCCCTGGCCGGGACCCAGCCCCAGCCGCTGTCGCTCGTCACCAAGTCTTTAGAA
TAGCTTTAGCGTCGTGAACCCCGCTGCTTTGTTTATGGTTTTGTTTCACTTTTCTTAATTTGCCCCCCACCCCCACCTTGAAAGGTTTTG
TTTTGTACTCTCTTAATTTTGTGCCATGTGGCTACATTAGTTGATGTTTATCGAGTTCATTGGTCAATATTTGACCCATTCTTATTTCAA
TTTCTCCTTTTAAATATGTAGATGAGAGAAGAACCTCATGATTCTACCAAAATTTTTATCAACAGCTGTTTAAAGTCTTTGTAGCGTTTA
AAAAATATATATATATACATAACTGTTATGTAGTTCGGATAGCTTAGTTTTAAAAGACTGATTAAAAAACAAAAAGAAAAAAAAAGCAAT
TTTGAAGCAGCCCTCCAGAAGGAGTTGGTTCTGTATTATTTGTATTAAATACGAGCTTGCGAACCAATCATTTTACATCTGGTTTTTAAA
CCGTAAGGGCACCATGAATGCAGTGCCGTTACTTTTTTTTTTTTTTTCTGTGTGAAACAACTCTTATTGTGATGTTACTTGTTATTGTTT
AAATGTACAGAAACAAAGGGTAAAAATGTGTTAATATACCTTGTTCCATGGTGTTGTTCTTTTGGGGGGAGGGGACGCTACTCAACACTT
AATAGAATCACAACGCTGTTGGGCCAGTAGTATTTATTGCTTTAGAGATTGCTTGTCGTACCTGTATGTCGTCCCTTTTTAAATATGTTT
TCCTTTTTCTTGAAACTGTATAAAGTTTTTTTCCCCCTTAGCATAAGCATCTTATATATAACAACTCATTTGTACAAGGTTTTTAAGTTT
ATATATAAAATGTGTATATATATTTTTGTTTCCCCTTTTTGACTTTTTTTTTTCTGTATGAAACCCAGATGTCACCAAATGGACATTAAT
AGTTGCATTAAGGATCAGTAGCATTAACAAAAGTTGCTTTAAAAGCCATTATGTAAAACAAGACTTGAAAATGAGTGAGGGAATTTTAGC
GACACTGTCTGAGCAGCAGTGGGAACCATCTTCGTTTCCCCTTTGAACTCCCAGTGGGATGCCCTACCCTGCGCCCTTAGGACCCGGACT
GACCGTGTACAAAACTTTACGTGCCAAAATTCTCAGTGAATTTAGCTTTCTCCCTCTTTTTGATGCTGTAATTTTTGTTCATCATGTTTT
GCTGTGATGTTACATAGGTAGATTTGTATGTAGTTTTAATGTCACCTATAACAAAATGTGTTTGGTAGCAGATTGTCCAGAAAGCATTTT
AAATGAAGAGGTATAAACCCTTAAGGGCCAAAATTCTGTATATTAGATTACTCTTAAACGAAAAACCAGCTGCCGCTTTTATGTACACAT
ATTACATACGAGTAGGCAGCAGACTTTAAAAATAAAAAAAACCTAGGCATGTTGATGTTGCAAAATGCTGTATAAAGCTGAAACCTGTTC
ATTCAGTGCCATTGTAGTTGACATGAAGCGATTGTAAAACTGTCTCCGATTTTTCTCTGGTTTATTAAAATGCTAACTATAACATTTTTT
GTGAATACTTTGAATGTTTCCTAACAGTTGTGATGTTACTGTTCCGTTTTATGCTCTTATTCCAAGTTCATTTTTAATGGTTTGGAAGCC

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000352065_chr10_114900943_+_2638nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC
ATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACGGGCATTCCGCATCCGGCCATAGTCACACCAACAGTC
AAACAGGAATCGTCCCAGAGTGATGTCGGCTCACTCCATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCAC
ATAAAGAAACCTCTTAATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGCGCGGCC
ATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACGAGCTGGCCCGGAAGGAGCGACAGCTT
CATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGGAAAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAAT
GAACACAGCGAATGTTTCCTAAATCCTTGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGC
CTTGATCAACAGAATAACTGGTGCGGCCCTTGCAGTCTTTGAATTTGGAATATTACAATGGAGAAAAAAAAAGTGCGTTCGCTACATACA

>In-frame_CHD7_ENST00000525508_chr8_61655656_+_TCF7L2_ENST00000369395_chr10_114900943_+_1994nt
ATGGCAGATCCAGGAATGATGAGTCTTTTTGGCGAGGATGGGAATATTTTCAGTGAAGGTCTTGAAGGCCTCGGAGAATGTGGTTACCCG
GAAAATCCAGTAAATCCTATGGGTCAGCAAATGCCAATAGACCAAGGCTTTGCCTCTTTACAGCCATCCCTTCATCATCCTTCAACTAAT
CAAAATCAAACAAAGCTGACACATTTTGATCACTATAATCAGTATGAACAACAAAAGATGCATCTGATGGATCAGCCGAACAGAATGATG
AGCAACACCCCTGGGAACGGACTCGCGTCTCCGCACTCGCAGTATCACACCCCTCCCGTTCCTCAGGTGCCCCATGGTGGCAGTGGTGGC
GGTCAGATGGGTGTCTACCCTGGCATGCAGAATGAGAGGCATGGGCAATCCTTTGTGGACAGCAGCTCCATGTGGGGCCCCAGGGCTGTT
CAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGCCACAGCCGCAGCCACCGCAGCCGGCTCCGTCGGGGCCCCCTGCACAG
GGCCACCCTCAGCACATGCAGCAGATGGGCAGCTATATGGCACGTGGGGATTTTTCCATGCAGCAGCATGGTCAGCCACAGCAGAGGATG
AGCCAGTTTTCCCAAGGCCAAGAGGGCCTCAATCAGGGAAATCCTTTTATTGCCACCTCAGGACCTGGCCACTTGTCCCACGTGCCCCAG
CAGAGTCCCAGCATGGCACCTTCCTTGCGTCACTCGGTGCAGCAGTTCCATCACCACCCCTCTACTGCTCTCCATGGAGAATCCGTTGCC
CACAGTCCCAGATTCTCCCCGAATCCTCCCCAACAAGGGGCTGTTAGGCCGCAAACCCTTAACTTTAGTTCTCGGAGCCAGACAGTCCCC
TCTCCTACTATAAACAACTCAGGGCAGTATTCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAATACAGGGATGAATCAA
AATTTAGGCCTTACAAATAATACTCCAATGAATCAGTCCGTACCAAGATACCCCAATGCTGTAGGATTCCCATCAAACAGTGGTCAAGGA
CTAATGCACCAGCAGCCCATCCACCCCAGTGGCTCACTTAACCAAATGAACACACAAACTATGCATCCTTCACAGCCTCAGGGAACTTAT
GCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAGTAATCCAGCAGGCACTCCTCCTCCACAAGTCAGGCCGGGAAGTGCTGGGATA
CCAATGGAAGTTGGCAGTTATCCAAATATGCCCCATCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATATG
GGCCCCAGAAACATGCAGCAGTCTCGTCCATTTATAGGCATGTCCTCGGCACCAAGGGAATTGACTGGGCACATGAGGCCAAATGGTTGT
CCTGGTGTTGGCCTTGGAGACCCACAAGCAATCCAGGAACGACTGATACCTGGCCAACAACATCCTGGTCAACAGCCATCTTTTCAGCAG
TTGCCAACCTGTCCTCCACTGCAGCCTCACCCGGGCTTGCACCACCAGTCTTCACCTCCACACCCTCATCACCAGCCTTGGGCACAGCTC
CACCCATCACCCCAGAACACCCCGCAGAAAGTGCCTGTGCATCAGTCTAACAAAGTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCC
CTCACGCCTCTTATCACGTACAGCAATGAACACTTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGA
ATCCCACGGCCTCCGCACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGCTAGGATGG
TTAGTACCACAGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCTGACCGTCAATGCTTCC


Top

FusionGenePPI for CHD7_TCF7L2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CHD7CTCF, TERF2, SMARCA4, SMARCC2, SMARCC1, SMARCE1, PBRM1, BRD7, ARID2, SOX2, MTA2, MTA1, GATAD2A, SALL3, ARID1A, ZBTB20, OLIG1, VARS, SIRT7, CHD8, NES, SNW1, POU5F1, WDR5, ASH2L, RBBP5, AR, TRIM25TCF7L2NLK, JUP, PSEN1, DAZAP2, CTNNB1, CTBP1, PARP1, XRCC6, XRCC5, ELAVL1, MAD2L2, ZBTB33, DAXX, FBLN1, UBE2I, PSMA3, PML, MEN1, USP4, HBP1, AR, FUS, CDC73, RNF138, HIC1, EP300, SMAD7, SETD8, LEF1, RNF43, TLE3, XIAP, IKZF5, PRMT6, UHRF2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CHD7_TCF7L2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CHD7_TCF7L2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCHD7C0265354CHARGE Syndrome14CTD_human;ORPHANET;UNIPROT
HgeneCHD7C3552553HYPOGONADOTROPIC HYPOGONADISM 5 WITH OR WITHOUT ANOSMIA4UNIPROT
TgeneTCF7L2C0036341Schizophrenia4PSYGENET
TgeneTCF7L2C0009404Colorectal Neoplasms2CTD_human
TgeneTCF7L2C0011860Diabetes Mellitus, Non-Insulin-Dependent2CTD_human
TgeneTCF7L2C0001418Adenocarcinoma1CTD_human
TgeneTCF7L2C0005586Bipolar Disorder1PSYGENET
TgeneTCF7L2C0009375Colonic Neoplasms1CTD_human
TgeneTCF7L2C0020507Hyperplasia1CTD_human
TgeneTCF7L2C0036337Schizoaffective Disorder1PSYGENET
TgeneTCF7L2C3495559Juvenile arthritis1CTD_human