FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6981

FusionGeneSummary for CHD3_RAD51C

check button Fusion gene summary
Fusion gene informationFusion gene name: CHD3_RAD51C
Fusion gene ID: 6981
HgeneTgene
Gene symbol

CHD3

RAD51C

Gene ID

1107

5889

Gene namechromodomain helicase DNA binding protein 3RAD51 paralog C
SynonymsMi-2a|Mi2-ALPHA|ZFHBROVCA3|FANCO|R51H3|RAD51L2
Cytomap

17p13.1

17q22

Type of geneprotein-codingprotein-coding
Descriptionchromodomain-helicase-DNA-binding protein 3ATP-dependent helicase CHD3CHD-3hZFHmi-2 autoantigen 240 kDa proteinzinc finger helicasezinc-finger helicase (Snf2-like)DNA repair protein RAD51 homolog 3RAD51-like protein 2yeast RAD51 homolog 3
Modification date2018052220180523
UniProtAcc

Q12873

O43502

Ensembl transtripts involved in fusion geneENST00000380358, ENST00000358181, 
ENST00000330494, ENST00000570758, 
ENST00000583539, ENST00000337432, 
ENST00000487921, ENST00000421782, 
Fusion gene scores* DoF score6 X 6 X 2=727 X 4 X 2=56
# samples 68
** MAII scorelog2(6/72*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/56*10)=0.514573172829758
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CHD3 [Title/Abstract] AND RAD51C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCHD3

GO:0007051

spindle organization

17626165

HgeneCHD3

GO:0007098

centrosome cycle

17626165

TgeneRAD51C

GO:0006281

DNA repair

19451272

TgeneRAD51C

GO:0006310

DNA recombination

19451272


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5KY-01ACHD3chr17

7797253

+RAD51Cchr17

56787220

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000380358ENST00000583539CHD3chr17

7797253

+RAD51Cchr17

56787220

+
In-frameENST00000380358ENST00000337432CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000380358ENST00000487921CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000380358ENST00000421782CHD3chr17

7797253

+RAD51Cchr17

56787220

+
In-frameENST00000358181ENST00000583539CHD3chr17

7797253

+RAD51Cchr17

56787220

+
In-frameENST00000358181ENST00000337432CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000358181ENST00000487921CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000358181ENST00000421782CHD3chr17

7797253

+RAD51Cchr17

56787220

+
In-frameENST00000330494ENST00000583539CHD3chr17

7797253

+RAD51Cchr17

56787220

+
In-frameENST00000330494ENST00000337432CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000330494ENST00000487921CHD3chr17

7797253

+RAD51Cchr17

56787220

+
5CDS-intronENST00000330494ENST00000421782CHD3chr17

7797253

+RAD51Cchr17

56787220

+
intron-3CDSENST00000570758ENST00000583539CHD3chr17

7797253

+RAD51Cchr17

56787220

+
intron-3CDSENST00000570758ENST00000337432CHD3chr17

7797253

+RAD51Cchr17

56787220

+
intron-intronENST00000570758ENST00000487921CHD3chr17

7797253

+RAD51Cchr17

56787220

+
intron-intronENST00000570758ENST00000421782CHD3chr17

7797253

+RAD51Cchr17

56787220

+

Top

FusionProtFeatures for CHD3_RAD51C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CHD3

Q12873

RAD51C

O43502

Component of the histone deacetylase NuRD complex whichparticipates in the remodeling of chromatin by deacetylatinghistones. Required for anchoring centrosomal pericentrin in bothinterphase and mitosis, for spindle organization and centrosomeintegrity. {ECO:0000269|PubMed:17626165,ECO:0000269|PubMed:9804427}. Essential for the homologous recombination (HR) pathwayof DNA repair. Involved in the homologous recombination repair(HRR) pathway of double-stranded DNA breaks arising during DNAreplication or induced by DNA-damaging agents. Part of the RAD21paralog protein complexes BCDX2 and CX3 which act at differentstages of the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage,BCDX2 seems to act downstream of BRCA2 recruitment and upstream ofRAD51 recruitment; CX3 seems to act downstream of RAD51recruitment; both complexes bind predominantly to the intersectionof the four duplex arms of the Holliday junction (HJ) and tojunction of replication forks. The BCDX2 complex was originallyreported to bind single-stranded DNA, single-stranded gaps induplex DNA and specifically to nicks in duplex DNA. The BCDX2subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependentATPase activity suggesting an involvement in early stages of theHR pathway. Involved in RAD51 foci formation in response to DNAdamage suggesting an involvement in early stages of HR probably inthe invasion step. Has an early function in DNA repair infacilitating phosphorylation of the checkpoint kinase CHEK2 andthereby transduction of the damage signal, leading to cell cyclearrest and HR activation. Participates in branch migration and HJresolution and thus is important for processing HR intermediateslate in the DNA repair process; the function may be linked to theCX3 complex. Part of a PALB2-scaffolded HR complex containingBRCA2 and which is thought to play a role in DNA repair by HR.Protects RAD51 from ubiquitin-mediated degradation that isenhanced following DNA damage. Plays a role in regulatingmitochondrial DNA copy number under conditions of oxidative stressin the presence of RAD51 and XRCC3. Contributes to DNA cross-linkresistance, sister chromatid cohesion and genomic stability.Involved in maintaining centrosome number in mitosis.{ECO:0000269|PubMed:14716019, ECO:0000269|PubMed:16215984,ECO:0000269|PubMed:16395335, ECO:0000269|PubMed:19451272,ECO:0000269|PubMed:19783859, ECO:0000269|PubMed:20413593,ECO:0000269|PubMed:23108668, ECO:0000269|PubMed:23149936}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640206_2213082001Compositional biasNote=Poly-Ala
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640243_2463082001Compositional biasNote=Poly-Pro
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639206_2213081967Compositional biasNote=Poly-Ala
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639243_2463081967Compositional biasNote=Poly-Pro
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640206_2213672060Compositional biasNote=Poly-Ala
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640243_2463672060Compositional biasNote=Poly-Pro
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640355_3583672060Compositional biasNote=Poly-Lys
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000337432+39366_370235377MotifNuclear localization signal
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000421782+02366_370-6136MotifNuclear localization signal
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000421782+02125_132-6136Nucleotide bindingATP
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000421782+021_126-6136RegionNote=Required for Holliday junction resolution activity

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640355_3583082001Compositional biasNote=Poly-Lys
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640434_4463082001Compositional biasNote=Poly-Glu
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640697_7033082001Compositional biasNote=Poly-Lys
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639355_3583081967Compositional biasNote=Poly-Lys
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639434_4463081967Compositional biasNote=Poly-Glu
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639697_7033081967Compositional biasNote=Poly-Lys
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640434_4463672060Compositional biasNote=Poly-Glu
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640697_7033672060Compositional biasNote=Poly-Lys
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+6401064_12293082001DomainHelicase C-terminal
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640494_5943082001DomainChromo 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640631_6733082001DomainChromo 2
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640748_9323082001DomainHelicase ATP-binding
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+6391064_12293081967DomainHelicase C-terminal
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639494_5943081967DomainChromo 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639631_6733081967DomainChromo 2
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639748_9323081967DomainHelicase ATP-binding
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+6401064_12293672060DomainHelicase C-terminal
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640494_5943672060DomainChromo 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640631_6733672060DomainChromo 2
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640748_9323672060DomainHelicase ATP-binding
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640883_8863082001MotifNote=DEAH box
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639883_8863081967MotifNote=DEAH box
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640883_8863672060MotifNote=DEAH box
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640761_7683082001Nucleotide bindingATP
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639761_7683081967Nucleotide bindingATP
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640761_7683672060Nucleotide bindingATP
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640379_4263082001Zinc fingerPHD-type 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000330494+640456_5033082001Zinc fingerPHD-type 2
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639379_4263081967Zinc fingerPHD-type 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000358181+639456_5033081967Zinc fingerPHD-type 2
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640379_4263672060Zinc fingerPHD-type 1
HgeneCHD3chr17:7797253chr17:56787220ENST00000380358+640456_5033672060Zinc fingerPHD-type 2
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000337432+39125_132235377Nucleotide bindingATP
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000337432+391_126235377RegionNote=Required for Holliday junction resolution activity


Top

FusionGeneSequence for CHD3_RAD51C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_479aa
MASPLRDEEEEEEEMVVSEEEEEEEEEGDEEEEEEVEAADEDDEEDDDEGVLGRGPGHDRGRDRHSPPGCHLFPPPPPPPPPLPPPPPPP
PPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKG
EGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAA
AAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGG
KRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWD

>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_509aa
MASPLRDEEEEEEEMVVSEEEEEEEEEGDEEEEEEVEAADEDDEEDDDEGVLGRGPGHDRGRDRHSPPGCHLFPPPPPPPPPLPPPPPPP
PPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKG
EGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAA
AAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGG
KRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWD

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_420aa
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSES
GGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKR
RSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMT

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_450aa
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSES
GGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKR
RSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMT
TKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEELX

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_420aa
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSES
GGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKR
RSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMT

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_450aa
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSES
GGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKR
RSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMT
TKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEELX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1437nt
ATGGCTTCCCCTCTGAGGGACGAGGAGGAGGAGGAGGAGGAGATGGTGGTGTCGGAGGAGGAAGAAGAGGAGGAAGAAGAGGGCGACGAG
GAGGAGGAGGAGGAGGTGGAGGCGGCCGACGAGGACGATGAGGAGGACGACGACGAGGGAGTACTCGGGCGCGGGCCGGGCCACGACCGG
GGCCGCGACCGCCACAGCCCCCCCGGCTGCCACCTCTTCCCGCCGCCGCCGCCGCCGCCGCCACCGCTGCCCCCGCCGCCGCCGCCCCCG
CCGCCAGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAG
CCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGGG
GGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGG
GAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTTC
TCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCCA
ATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCG
GCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGCC
CTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGG
AGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGGC
AAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCGT
ACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAACA
AAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGAC

>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1527nt
ATGGCTTCCCCTCTGAGGGACGAGGAGGAGGAGGAGGAGGAGATGGTGGTGTCGGAGGAGGAAGAAGAGGAGGAAGAAGAGGGCGACGAG
GAGGAGGAGGAGGAGGTGGAGGCGGCCGACGAGGACGATGAGGAGGACGACGACGAGGGAGTACTCGGGCGCGGGCCGGGCCACGACCGG
GGCCGCGACCGCCACAGCCCCCCCGGCTGCCACCTCTTCCCGCCGCCGCCGCCGCCGCCGCCACCGCTGCCCCCGCCGCCGCCGCCCCCG
CCGCCAGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAG
CCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGGG
GGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGG
GAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTTC
TCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCCA
ATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCG
GCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGCC
CTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGG
AGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGGC
AAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCGT
ACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAACA
AAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGAC
CGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAACCTCAGGGATTTAGAGAT

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1260nt
ATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGAC
AGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAAC
AAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGT
GGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAG
GGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTG
TTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATC
CCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCG
GCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCC
GCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGG
CGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGT
GGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTT
CGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACA
ACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGG
GACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAAGTCAGTATTATTTGA

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1350nt
ATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGAC
AGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAAC
AAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGT
GGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAG
GGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTG
TTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATC
CCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCG
GCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCC
GCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGG
CGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGT
GGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTT
CGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACA
ACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGG
GACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAACCTCAGGGATTTAGA
GATACTGTTGTTACTTCTGCATGTTCATTGCAAACAGAAGGTTCCTTGAGCACCCGGAAACGGTCACGAGACCCAGAGGAAGAATTATAA

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1260nt
ATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGAC
AGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAAC
AAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGT
GGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAG
GGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTG
TTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATC
CCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCG
GCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCC
GCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGG
CGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGT
GGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTT
CGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACA
ACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGG
GACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAAGTCAGTATTATTTGA

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1350nt
ATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGAC
AGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAAC
AAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGT
GGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAG
GGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTG
TTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATC
CCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCG
GCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCC
GCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGG
CGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGT
GGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTT
CGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACA
ACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGG
GACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAACCTCAGGGATTTAGA
GATACTGTTGTTACTTCTGCATGTTCATTGCAAACAGAAGGTTCCTTGAGCACCCGGAAACGGTCACGAGACCCAGAGGAAGAATTATAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1645nt
GATGGCTTCCCCTCTGAGGGACGAGGAGGAGGAGGAGGAGGAGATGGTGGTGTCGGAGGAGGAAGAAGAGGAGGAAGAAGAGGGCGACGA
GGAGGAGGAGGAGGAGGTGGAGGCGGCCGACGAGGACGATGAGGAGGACGACGACGAGGGAGTACTCGGGCGCGGGCCGGGCCACGACCG
GGGCCGCGACCGCCACAGCCCCCCCGGCTGCCACCTCTTCCCGCCGCCGCCGCCGCCGCCGCCACCGCTGCCCCCGCCGCCGCCGCCCCC
GCCGCCAGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAA
GCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGG
GGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGG
GGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTT
CTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCC
AATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGC
GGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGC
CCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCG
GAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGG
CAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCG
TACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAAC
AAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGA
CCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAAGTCAGTATTATTTGATT
AGAGTGGGATTTTGATATTGATGGGCGGTAATTATCTAAAGAGAGAATTTACAACTTGCTTCTGTCAACTTCTGTAGGCAGCAAGCATAT
TTGAGGACAGCTTTTGATGCTTAGAACATTGTCCCCAAAATAGTAGTATATACAGAATATTGTAGTCACAAATGGACTGAAATTTATTCT

>In-frame_CHD3_ENST00000380358_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1648nt
GATGGCTTCCCCTCTGAGGGACGAGGAGGAGGAGGAGGAGGAGATGGTGGTGTCGGAGGAGGAAGAAGAGGAGGAAGAAGAGGGCGACGA
GGAGGAGGAGGAGGAGGTGGAGGCGGCCGACGAGGACGATGAGGAGGACGACGACGAGGGAGTACTCGGGCGCGGGCCGGGCCACGACCG
GGGCCGCGACCGCCACAGCCCCCCCGGCTGCCACCTCTTCCCGCCGCCGCCGCCGCCGCCGCCACCGCTGCCCCCGCCGCCGCCGCCCCC
GCCGCCAGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAA
GCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGG
GGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGG
GGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTT
CTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCC
AATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGC
GGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGC
CCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCG
GAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGG
CAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCG
TACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAAC
AAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGA
CCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAACCTCAGGGATTTAGAGA
TACTGTTGTTACTTCTGCATGTTCATTGCAAACAGAAGGTTCCTTGAGCACCCGGAAACGGTCACGAGACCCAGAGGAAGAATTATAACC
CAGAAACAAATCTCAAAGTGTACAAATTTATTGATGTTGTGAAATCAATGTGTACAAGTGGACTTGTTACCTTAAAGTATAAATAAACAC

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1677nt
ATCTTTGTTTGGGTCTCCCATACTGCGTATAGATGAATGGGTCAGGATATCTGGAACAAAATATGGAGGTGAAGGGTGAGATCGGGAAAC
AAAGGGTATGGCCCCCTAGTTCCCAAAGGGAGCAGGGAGATGGGAATAGAATTGAAGGTAGGTTTTAGGCTACTTGGGAGGAGGAATATT
TAGGTAATTGTGGAGACTTTCTCCTGTGTGATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATT
TCTTTTCCTCCAGGACTGTGTTGGGGTGACAGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGA
AAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAG
CGAGATGAGTACCGGGAGAAGTCAGAGAGTGGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAA
AAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTG
ACCTGGGGCCTGGAGGATGTGGAGCATGTGTTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGG
CCCCTAATTGCTAAGAAGAATCCTAAGATCCCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAAC
CCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCG
GCCACCCCCATAGCACCCTCCGGACCCCCCGCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACC
AAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCA
CCACTCAAAATAAAACTAGGGCTTCTGGGTGGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCA
TTTCGTCATGACCTAGATGACCTGTCTCTTCGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGA
TTAGCTGTAATTTTAACCAATCAGATGACAACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACAT
GCTGCTACAATACGGCTAATCTTTCATTGGGACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTA
CTGTTTCAAATCAAAGTCAGTATTATTTGATTAGAGTGGGATTTTGATATTGATGGGCGGTAATTATCTAAAGAGAGAATTTACAACTTG
CTTCTGTCAACTTCTGTAGGCAGCAAGCATATTTGAGGACAGCTTTTGATGCTTAGAACATTGTCCCCAAAATAGTAGTATATACAGAAT

>In-frame_CHD3_ENST00000358181_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1680nt
ATCTTTGTTTGGGTCTCCCATACTGCGTATAGATGAATGGGTCAGGATATCTGGAACAAAATATGGAGGTGAAGGGTGAGATCGGGAAAC
AAAGGGTATGGCCCCCTAGTTCCCAAAGGGAGCAGGGAGATGGGAATAGAATTGAAGGTAGGTTTTAGGCTACTTGGGAGGAGGAATATT
TAGGTAATTGTGGAGACTTTCTCCTGTGTGATGAAGGCGGCAGACACTGTGATCCTGTGGGCAAGAAGTAAAAATGACCAGCTGAGGATT
TCTTTTCCTCCAGGACTGTGTTGGGGTGACAGGATGCCTGATAAGGATGACATTCGGCTGCTGCCGTCAGCATTGGGTGTGAAGAAGAGA
AAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGAAAACCCCGAAAACGCAAGAAGCGTGACAGTGAGGAGGAATTTGGTTCTGAG
CGAGATGAGTACCGGGAGAAGTCAGAGAGTGGGGGCAGTGAATATGGAACCGGACCGGGTCGGAAACGAAGAAGGAAGCACCGAGAAAAA
AAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGGGAGGGAGATGGGGGGCAAAAGCAAGTGGAACAGAAGTCATCAGCAACTCTGCTTCTG
ACCTGGGGCCTGGAGGATGTGGAGCATGTGTTCTCTGAGGAGGATTACCACACGCTCACCAACTACAAAGCCTTCAGCCAGTTCATGAGG
CCCCTAATTGCTAAGAAGAATCCTAAGATCCCAATGTCTAAGATGATGACCATCCTTGGGGCCAAATGGAGAGAGTTCAGTGCCAACAAC
CCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCGGCAGCGGCAGCAGCAGCAGCAGCTGTAGCTGAGCAGGTGTCAGCTGCTGTCTCGTCG
GCCACCCCCATAGCACCCTCCGGACCCCCCGCCCTTCCACCACCCCCTGCTGCTGATATCCAGCCCCCACCCATCCGAAGAGCCAAAACC
AAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGGAGTAAGAGCCCCCGAGTGCCTGATGGACGCAAGAAGCTTCGGGGAAAGAAAATGGCA
CCACTCAAAATAAAACTAGGGCTTCTGGGTGGCAAGAGGAAGAAAGGAGGCTCGGTTCGACTAGTGATAGTGGATGGTATTGCTTTTCCA
TTTCGTCATGACCTAGATGACCTGTCTCTTCGTACTCGGTTATTAAATGGCCTAGCCCAGCAAATGATCAGCCTTGCAAATAATCACAGA
TTAGCTGTAATTTTAACCAATCAGATGACAACAAAGATTGATAGAAATCAGGCCTTGCTTGTTCCTGCATTAGGGGAAAGTTGGGGACAT
GCTGCTACAATACGGCTAATCTTTCATTGGGACCGAAAGCAAAGGTTGGCAACATTGTACAAGTCACCCAGCCAGAAGGAATGCACAGTA
CTGTTTCAAATCAAACCTCAGGGATTTAGAGATACTGTTGTTACTTCTGCATGTTCATTGCAAACAGAAGGTTCCTTGAGCACCCGGAAA
CGGTCACGAGACCCAGAGGAAGAATTATAACCCAGAAACAAATCTCAAAGTGTACAAATTTATTGATGTTGTGAAATCAATGTGTACAAG

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000583539_chr17_56787220_+_1617nt
ATATGGAGGTGAAGGGTGAGATCGGGAAACAAAGGGTATGGCCCCCTAGTTCCCAAAGGGAGCAGGGAGATGGGAATAGAATTGAAGGTA
GGTTTTAGGCTACTTGGGAGGAGGAATATTTAGGTAATTGTGGAGACTTTCTCCTGTGTGATGAAGGCGGCAGACACTGTGATCCTGTGG
GCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGACAGGATGCCTGATAAGGATGACATTCGGCTG
CTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGAAAACCCCGAAAACGCAAGAAG
CGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGGGGGCAGTGAATATGGAACCGGACCGGGT
CGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGGGAGGGAGATGGGGGGCAAAAGCAAGTG
GAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTTCTCTGAGGAGGATTACCACACGCTCACC
AACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCCAATGTCTAAGATGATGACCATCCTTGGG
GCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCGGCAGCGGCAGCAGCAGCAGCAGCTGTA
GCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGCCCTTCCACCACCCCCTGCTGCTGATATC
CAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGGAGTAAGAGCCCCCGAGTGCCTGATGGA
CGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGGCAAGAGGAAGAAAGGAGGCTCGGTTCGA
CTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCGTACTCGGTTATTAAATGGCCTAGCCCAG
CAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAACAAAGATTGATAGAAATCAGGCCTTGCTT
GTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGACCGAAAGCAAAGGTTGGCAACATTGTAC
AAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAAGTCAGTATTATTTGATTAGAGTGGGATTTTGATATTGATGGGCGG
TAATTATCTAAAGAGAGAATTTACAACTTGCTTCTGTCAACTTCTGTAGGCAGCAAGCATATTTGAGGACAGCTTTTGATGCTTAGAACA

>In-frame_CHD3_ENST00000330494_chr17_7797253_+_RAD51C_ENST00000337432_chr17_56787220_+_1620nt
ATATGGAGGTGAAGGGTGAGATCGGGAAACAAAGGGTATGGCCCCCTAGTTCCCAAAGGGAGCAGGGAGATGGGAATAGAATTGAAGGTA
GGTTTTAGGCTACTTGGGAGGAGGAATATTTAGGTAATTGTGGAGACTTTCTCCTGTGTGATGAAGGCGGCAGACACTGTGATCCTGTGG
GCAAGAAGTAAAAATGACCAGCTGAGGATTTCTTTTCCTCCAGGACTGTGTTGGGGTGACAGGATGCCTGATAAGGATGACATTCGGCTG
CTGCCGTCAGCATTGGGTGTGAAGAAGAGAAAACGAGGACCCAAGAAGCAGAAGGAGAACAAGCCAGGAAAACCCCGAAAACGCAAGAAG
CGTGACAGTGAGGAGGAATTTGGTTCTGAGCGAGATGAGTACCGGGAGAAGTCAGAGAGTGGGGGCAGTGAATATGGAACCGGACCGGGT
CGGAAACGAAGAAGGAAGCACCGAGAAAAAAAGGAGAAGAAGACAAAGCGGCGGAAAAAGGGGGAGGGAGATGGGGGGCAAAAGCAAGTG
GAACAGAAGTCATCAGCAACTCTGCTTCTGACCTGGGGCCTGGAGGATGTGGAGCATGTGTTCTCTGAGGAGGATTACCACACGCTCACC
AACTACAAAGCCTTCAGCCAGTTCATGAGGCCCCTAATTGCTAAGAAGAATCCTAAGATCCCAATGTCTAAGATGATGACCATCCTTGGG
GCCAAATGGAGAGAGTTCAGTGCCAACAACCCCTTCAAGGGGTCAGCAGCTGCTGTGGCGGCGGCAGCGGCAGCAGCAGCAGCAGCTGTA
GCTGAGCAGGTGTCAGCTGCTGTCTCGTCGGCCACCCCCATAGCACCCTCCGGACCCCCCGCCCTTCCACCACCCCCTGCTGCTGATATC
CAGCCCCCACCCATCCGAAGAGCCAAAACCAAAGAGGGCAAAGGTCCAGGCCATAAGAGGCGGAGTAAGAGCCCCCGAGTGCCTGATGGA
CGCAAGAAGCTTCGGGGAAAGAAAATGGCACCACTCAAAATAAAACTAGGGCTTCTGGGTGGCAAGAGGAAGAAAGGAGGCTCGGTTCGA
CTAGTGATAGTGGATGGTATTGCTTTTCCATTTCGTCATGACCTAGATGACCTGTCTCTTCGTACTCGGTTATTAAATGGCCTAGCCCAG
CAAATGATCAGCCTTGCAAATAATCACAGATTAGCTGTAATTTTAACCAATCAGATGACAACAAAGATTGATAGAAATCAGGCCTTGCTT
GTTCCTGCATTAGGGGAAAGTTGGGGACATGCTGCTACAATACGGCTAATCTTTCATTGGGACCGAAAGCAAAGGTTGGCAACATTGTAC
AAGTCACCCAGCCAGAAGGAATGCACAGTACTGTTTCAAATCAAACCTCAGGGATTTAGAGATACTGTTGTTACTTCTGCATGTTCATTG
CAAACAGAAGGTTCCTTGAGCACCCGGAAACGGTCACGAGACCCAGAGGAAGAATTATAACCCAGAAACAAATCTCAAAGTGTACAAATT
TATTGATGTTGTGAAATCAATGTGTACAAGTGGACTTGTTACCTTAAAGTATAAATAAACACACTATGGCATGAATGAATCCAGATCATA


Top

FusionGenePPI for CHD3_RAD51C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CHD3UBE2I, SERBP1, MBD3L1, HDAC2, MTA2, MBD2, HABP4, HDAC1, TP53, TP73, SUMO1, SMARCA5, RAD21, ADH5, ATPIF1, CASP6, FBP2, HSPH1, PCMT1, SERF2, TSPAN6, CASP8, CPE, C4orf17, CTTN, IVNS1ABP, THOC7, PRG2, PTPRS, SGSM2, SAT1, SDCCAG3, TNFRSF14, UBA3, XRCC4, SRRT, FAM134A, YAE1D1, IMMT, GPS2, IK, KIF15, LUC7L2, MAFG, MAN2A2, CRCT1, PAICS, PSME1, RPL29, SAFB, TRIM28, TTR, TXNDC9, BHLHE40, CREB1, FUBP1, RAD51, PUF60, SIRT6, SLC27A6, CSTF2, PTN, SUMO2, CHD6, HIST1H3A, NAB2, MTA3, SIN3A, SMARCA2, TAF6, MTA1, BCL6, HSF1, CSNK2A1, PCNT, MYB, DDX5, JUN, HIC1, CHD4, CHD3, RBBP4, KDM1A, TAL1, GSK3B, UROD, AIMP2, TNNT1, FABP4, HSD17B10, RGS2, CTBP1, PLK4, NR1H2, TSC22D1, NR4A1, GADD45A, KDM5B, TWIST1, HTT, GIT1, BARD1, PRPF40A, VIM, LRIF1, PIAS4, ZHX1, NEFL, TCERG1, KPNB1, IKZF1, MBD3, RBBP7, GATAD2A, SMARCC2, HDAC3, UBC, SIRT1, SKIL, SOX2, LGR4, ENO1, SHMT2, MOV10, NXF1, PHF6, CCDC8, RNF2, BMI1, ZNF219, PHF20L1, GATAD2B, CD2BP2, OTUD6B, SNRNP40, CPSF1, METAP2, MX1, KMT2A, SATB1, RPL10, CDK2AP1, PSMD14, HIST1H2BB, MCM2, SNW1, HYPK, HSFY1, FOXA1, TRIM25, UHRF2, BRD1, ZNF827RAD51CRAD51, RAD51B, XRCC3, XRCC2, RAD51D, APP, SWSAP1, BSG, SPACA1, IL12RB1, CBWD1, TGOLN2, WNT4, THBS3, KLHL10, PTPN9, CCDC140, EFNB3, DKKL1, FAM174A, ADAMTS4, HENMT1, HELQ, PALB2, BRCA2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000421782+0279_136-6136RAD51B%2C RAD51D and XRCC3


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneRAD51Cchr17:7797253chr17:56787220ENST00000337432+3979_136235377RAD51B%2C RAD51D and XRCC3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CHD3_RAD51C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CHD3_RAD51C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCHD3C0036920Sezary Syndrome1CTD_human
TgeneRAD51CC3150659BREAST-OVARIAN CANCER, FAMILIAL, SUSCEPTIBILITY TO, 33CTD_human;UNIPROT
TgeneRAD51CC3150653FANCONI ANEMIA, COMPLEMENTATION GROUP O2CTD_human;UNIPROT
TgeneRAD51CC0015625Fanconi Anemia1CTD_human;ORPHANET
TgeneRAD51CC0919267ovarian neoplasm1CTD_human
TgeneRAD51CC1458155Mammary Neoplasms1CTD_human