FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6761

FusionGeneSummary for CENPF_EGLN1

check button Fusion gene summary
Fusion gene informationFusion gene name: CENPF_EGLN1
Fusion gene ID: 6761
HgeneTgene
Gene symbol

CENPF

EGLN1

Gene ID

1063

54583

Gene namecentromere protein Fegl-9 family hypoxia inducible factor 1
SynonymsCENF|CILD31|PRO1779|STROMS|hcp-1C1orf12|ECYT3|HALAH|HIF-PH2|HIFPH2|HPH-2|HPH2|PHD2|SM20|ZMYND6
Cytomap

1q41

1q42.2

Type of geneprotein-codingprotein-coding
Descriptioncentromere protein FAH antigenCENP-F kinetochore proteincell-cycle-dependent 350K nuclear proteincentromere protein F, 350/400kDakinetochore protein CENPFmitosinegl nine homolog 1HIF-prolyl hydroxylase 2egl nine-like protein 1hypoxia-inducible factor prolyl hydroxylase 2prolyl hydroxylase domain-containing protein 2zinc finger MYND domain-containing protein 6
Modification date2018052220180527
UniProtAcc

P49454

Q9GZT9

Ensembl transtripts involved in fusion geneENST00000366955, ENST00000467765, 
ENST00000366641, ENST00000476717, 
Fusion gene scores* DoF score5 X 4 X 3=605 X 3 X 3=45
# samples 45
** MAII scorelog2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/45*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CENPF [Title/Abstract] AND EGLN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCENPF

GO:0015031

protein transport

12974617

HgeneCENPF

GO:0045892

negative regulation of transcription, DNA-templated

15677469

HgeneCENPF

GO:0051310

metaphase plate congression

15870278

TgeneEGLN1

GO:0001666

response to hypoxia

16956324

TgeneEGLN1

GO:0018401

peptidyl-proline hydroxylation to 4-hydroxy-L-proline

11598268

TgeneEGLN1

GO:0032364

oxygen homeostasis

16956324

TgeneEGLN1

GO:0043433

negative regulation of DNA binding transcription factor activity

16956324

TgeneEGLN1

GO:0071731

response to nitric oxide

21601578


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-56-7582-01ACENPFchr1

214795624

+EGLN1chr1

231509845

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000366955ENST00000366641CENPFchr1

214795624

+EGLN1chr1

231509845

-
5CDS-5UTRENST00000366955ENST00000476717CENPFchr1

214795624

+EGLN1chr1

231509845

-
intron-3CDSENST00000467765ENST00000366641CENPFchr1

214795624

+EGLN1chr1

231509845

-
intron-5UTRENST00000467765ENST00000476717CENPFchr1

214795624

+EGLN1chr1

231509845

-

Top

FusionProtFeatures for CENPF_EGLN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CENPF

P49454

EGLN1

Q9GZT9

Required for kinetochore function and chromosomesegregation in mitosis. Required for kinetochore localization ofdynein, LIS1, NDE1 and NDEL1. Regulates recycling of the plasmamembrane by acting as a link between recycling vesicles and themicrotubule network though its association with STX4 and SNAP25.Acts as a potential inhibitor of pocket protein-mediated cellularprocesses during development by regulating the activity of RBproteins during cell division and proliferation. May play aregulatory or permissive role in the normal embryoniccardiomyocyte cell cycle and in promoting continued mitosis intransformed, abnormally dividing neonatal cardiomyocytes.Interaction with RB directs embryonic stem cells toward a cardiaclineage. Involved in the regulation of DNA synthesis and hencecell cycle progression, via its C-terminus. Has a potential roleregulating skeletal myogenesis and in cell differentiation inembryogenesis. Involved in dendritic cell regulation of T-cellimmunity against chlamydia. {ECO:0000269|PubMed:12974617,ECO:0000269|PubMed:17600710, ECO:0000269|PubMed:7542657,ECO:0000269|PubMed:7651420}. Cellular oxygen sensor that catalyzes, under normoxicconditions, the post-translational formation of 4-hydroxyprolinein hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates aspecific proline found in each of the oxygen-dependent degradation(ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A.Also hydroxylates HIF2A. Has a preference for the CODD site forboth HIF1A and HIF1B. Hydroxylated HIFs are then targeted forproteasomal degradation via the von Hippel-Lindau ubiquitinationcomplex. Under hypoxic conditions, the hydroxylation reaction isattenuated allowing HIFs to escape degradation resulting in theirtranslocation to the nucleus, heterodimerization with HIF1B, andincreased expression of hypoxy-inducible genes. EGLN1 is the mostimportant isozyme under normoxia and, through regulating thestability of HIF1, involved in various hypoxia-influencedprocesses such as angiogenesis in retinal and cardiacfunctionality. Target proteins are preferentially recognized via aLXXLAP motif. {ECO:0000269|PubMed:11595184,ECO:0000269|PubMed:12181324, ECO:0000269|PubMed:12351678,ECO:0000269|PubMed:15897452, ECO:0000269|PubMed:19339211,ECO:0000269|PubMed:21792862, ECO:0000269|PubMed:25129147}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+72014_1973563115Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201642_17463563115Coiled coilOntology_term=ECO:0000255
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201862_29873563115Coiled coilOntology_term=ECO:0000255
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+720273_7693563115Coiled coilOntology_term=ECO:0000255
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+720823_13283563115Coiled coilOntology_term=ECO:0000255
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7203015_30323563115MotifNuclear localization signal
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201435_16263563115RegionNote=2 X 96 AA approximate tandem repeats
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202207_25683563115RegionNote=2 X 177 AA tandem repeats
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202488_29253563115RegionNote=Sufficient for self-association
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202488_31133563115RegionNote=Sufficient for centromere localization
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202927_31133563115RegionNote=Sufficient for nuclear localization
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201435_15303563115RepeatNote=1-1
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201531_16263563115RepeatNote=1-2
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202207_23863563115RepeatNote=2-1
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202389_25683563115RepeatNote=2-2
TgeneEGLN1chr1:214795624chr1:231509845ENST00000366641-05291_392297427DomainFe2OG dioxygenase
TgeneEGLN1chr1:214795624chr1:231509845ENST00000366641-05241_251297427RegionBeta(2)beta(3) 'finger-like' loop
TgeneEGLN1chr1:214795624chr1:231509845ENST00000366641-056_20297427RegionNote=Required for nuclear export
TgeneEGLN1chr1:214795624chr1:231509845ENST00000366641-0521_58297427Zinc fingerMYND-type


Top

FusionGeneSequence for CENPF_EGLN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CENPF_ENST00000366955_chr1_214795624_+_EGLN1_ENST00000366641_chr1_231509845_-_486aa
MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKTEGTNLKRENQRLMEICESLEKTKQKISHEL
QVKESQVNFQEGQLNSGKKQIEKLEQELKRCKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQTTSGSKTEDLKEKTNKEVEERKR
LEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQQEKTPSHLSSNSQRTPIRRDFSASYFSGEQEVTPSRSTLQIGKRDANSSF
FDNSSSPHLLDQLKAQNQELRNKINELELRLQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQYDQASTKAMVA
CTPGNGTGTVRHVDNPNGDGRCVTCITTLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPATATRYAITVWTF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CENPF_ENST00000366955_chr1_214795624_+_EGLN1_ENST00000366641_chr1_231509845_-_1458nt
ATGAGCTGGGCTTTGGAAGAATGGAAAGAAGGGCTGCCTACAAGAGCTCTTCAGAAAATTCAAGAGCTTGAAGGACAGCTTGACAAACTG
AAGAAGGAAAAGCAGCAAAGGCAGTTTCAGCTTGACAGTCTCGAGGCTGCGCTGCAGAAGCAAAAACAGAAGGTTGAAAATGAAAAAACC
GAGGGTACAAACCTGAAAAGGGAGAATCAAAGATTGATGGAAATATGTGAAAGTCTGGAGAAAACTAAGCAGAAGATTTCTCATGAACTT
CAAGTCAAGGAGTCACAAGTGAATTTCCAGGAAGGACAACTGAATTCAGGCAAAAAACAAATAGAAAAACTGGAACAGGAACTTAAAAGG
TGTAAATCTGAGCTTGAAAGAAGCCAACAAGCTGCGCAGTCTGCAGATGTCTCTCTGAATCCATGCAATACACCACAAAAAATTTTTACA
ACTCCACTAACACCAAGTCAATATTATAGTGGTTCCAAGTATGAAGATCTAAAAGAAAAATATAATAAAGAGGTTGAAGAACGAAAAAGA
TTAGAGGCAGAGGTTAAAGCCTTGCAGGCTAAAAAAGCAAGCCAGACTCTTCCACAAGCCACCATGAATCACCGCGACATTGCCCGGCAT
CAGGCTTCATCATCTGTGTTCTCATGGCAGCAAGAGAAGACCCCAAGTCATCTTTCATCTAATTCTCAAAGAACTCCAATTAGGAGAGAT
TTCTCTGCATCTTACTTTTCTGGGGAACAAGAGGTGACTCCAAGTCGATCAACTTTGCAAATAGGGAAAAGAGATGCTAATAGCAGTTTC
TTTGACAATTCTAGCAGTCCTCATCTTTTGGATCAATTAAAAGCGCAGAATCAAGAGCTAAGAAACAAGATTAATGAGTTGGAACTACGC
CTGCAAGGACATGAAAAAGAAATGAAAGGCCAAGTGAATAAGTTTCAAGAACTCCAACTCCAACTGGAGAAAGCAAAAGTGGAATTAATT
GAAAAAGAGAAAGTTTTGAACAAATGTAGGGATGAACTAGTGAGAACAACAGCACAATACGACCAGGCGTCAACCAAGGCCATGGTTGCT
TGTTATCCGGGCAATGGAACGGGTTATGTACGTCATGTTGATAATCCAAATGGAGATGGAAGATGTGTGACATGTATATATTATCTTAAT
AAAGACTGGGATGCCAAGGTAAGTGGAGGTATACTTCGAATTTTTCCAGAAGGCAAAGCCCAGTTTGCTGACATTGAACCCAAATTTGAT
AGACTGCTGTTTTTCTGGTCTGACCGTCGCAACCCTCATGAAGTACAACCAGCATATGCTACAAGGTACGCAATAACTGTTTGGTATTTT
GATGCAGATGAGAGAGCACGAGCTAAAGTAAAATATCTAACAGGTGAAAAAGGTGTGAGGGTTGAACTCAATAAACCTTCAGATTCGGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CENPF_ENST00000366955_chr1_214795624_+_EGLN1_ENST00000366641_chr1_231509845_-_4286nt
AGAAGCGGGCGAATTGGGCACCGGTGGCGGCTGCGGGCAGTTTGAATTAGACTCTGGGCTCCAGCCCGCCGAAGCCGCGCCAGAACTGTA
CTCTCCGAGAGGTCGTTTTCCCGTCCCCGAGAGCAAGTTTATTTACAAATGTTGGAGTAATAAAGAAGGCAGAACAAAATGAGCTGGGCT
TTGGAAGAATGGAAAGAAGGGCTGCCTACAAGAGCTCTTCAGAAAATTCAAGAGCTTGAAGGACAGCTTGACAAACTGAAGAAGGAAAAG
CAGCAAAGGCAGTTTCAGCTTGACAGTCTCGAGGCTGCGCTGCAGAAGCAAAAACAGAAGGTTGAAAATGAAAAAACCGAGGGTACAAAC
CTGAAAAGGGAGAATCAAAGATTGATGGAAATATGTGAAAGTCTGGAGAAAACTAAGCAGAAGATTTCTCATGAACTTCAAGTCAAGGAG
TCACAAGTGAATTTCCAGGAAGGACAACTGAATTCAGGCAAAAAACAAATAGAAAAACTGGAACAGGAACTTAAAAGGTGTAAATCTGAG
CTTGAAAGAAGCCAACAAGCTGCGCAGTCTGCAGATGTCTCTCTGAATCCATGCAATACACCACAAAAAATTTTTACAACTCCACTAACA
CCAAGTCAATATTATAGTGGTTCCAAGTATGAAGATCTAAAAGAAAAATATAATAAAGAGGTTGAAGAACGAAAAAGATTAGAGGCAGAG
GTTAAAGCCTTGCAGGCTAAAAAAGCAAGCCAGACTCTTCCACAAGCCACCATGAATCACCGCGACATTGCCCGGCATCAGGCTTCATCA
TCTGTGTTCTCATGGCAGCAAGAGAAGACCCCAAGTCATCTTTCATCTAATTCTCAAAGAACTCCAATTAGGAGAGATTTCTCTGCATCT
TACTTTTCTGGGGAACAAGAGGTGACTCCAAGTCGATCAACTTTGCAAATAGGGAAAAGAGATGCTAATAGCAGTTTCTTTGACAATTCT
AGCAGTCCTCATCTTTTGGATCAATTAAAAGCGCAGAATCAAGAGCTAAGAAACAAGATTAATGAGTTGGAACTACGCCTGCAAGGACAT
GAAAAAGAAATGAAAGGCCAAGTGAATAAGTTTCAAGAACTCCAACTCCAACTGGAGAAAGCAAAAGTGGAATTAATTGAAAAAGAGAAA
GTTTTGAACAAATGTAGGGATGAACTAGTGAGAACAACAGCACAATACGACCAGGCGTCAACCAAGGCCATGGTTGCTTGTTATCCGGGC
AATGGAACGGGTTATGTACGTCATGTTGATAATCCAAATGGAGATGGAAGATGTGTGACATGTATATATTATCTTAATAAAGACTGGGAT
GCCAAGGTAAGTGGAGGTATACTTCGAATTTTTCCAGAAGGCAAAGCCCAGTTTGCTGACATTGAACCCAAATTTGATAGACTGCTGTTT
TTCTGGTCTGACCGTCGCAACCCTCATGAAGTACAACCAGCATATGCTACAAGGTACGCAATAACTGTTTGGTATTTTGATGCAGATGAG
AGAGCACGAGCTAAAGTAAAATATCTAACAGGTGAAAAAGGTGTGAGGGTTGAACTCAATAAACCTTCAGATTCGGTCGGTAAAGACGTC
TTCTAGAGCCTTTGATCCAGCAATACCCCACTTCACCTACAATATTGTTAACTATTTGTTAACTTGTGAATACGAATAAATGGGATAAAG
AAAAATAGACAACCAGTTCGCATTTTAATAAGGAAACAGAAACAACTTTTTGTGTTGCATCAAACAGAAGATTTTGACTGCTGTGACTTT
GTACTGCATGATCAACTTCAAATCTGTGATTGCTTACAGGAGGAAGATAAGCTACTAATTGAAAATGGTTTTTACATCTGGATATGAAAT
AAGTGCCCTGTGTAGAATTTTTTTCATTCTTATATTTTGCCAGATCTGTTATCTAGCTGAGTTCATTTCATCTCTCCCTTTTTTATATCA
AGTTTGAATTTGGGATAATTTTTCTATATTAGGTACAATTTATCTAAACTGAATTGAGAAAAAATTACAGTATTATTCCTCAAAATAACA
TCAATCTATTTTTGTAAACCTGTTCATACTATTAAATTTTGCCCTAAAAGACCTCTTAATAATGATTGTTGCCAGTGACTGATGATTAAT
TTTATTTTACTTAAAATAAGAAAAGGAGCACTTTAATTACAACTGAAAAATCAGATTGTTTTGTAGTCCTTCCTTACACTAATTTGAACT
GTTAAAGATTGCTGCTTTTTTTTTGACATTGTCAATAACGAAACCTAATTGTAAAACAGTCACCATTTACTACCAATAACTTTTAGTTAA
TGTTTTACAAGGAAAAAGACACAAGAAGAGTTTAAATTTTTTTGTTTTGTTTTGTTTTTTTGAGACAGTCTTGCTCTGTTACCCAGGCTG
GAGGGGAGTGGTGCATTCTTGGCTCACTGCAACCTCCGCCTCCCAGGTTCAAGCAATCCTCCCACCTCAGCCTCCCAACTAGCTGGGACT
GCAGGCACACACCACCATGCCTGACTAATTTTTGTATGTTTAGTAGAGACGGGGTTTTGCCATGTTGCCTAGGCTGGGGTTTAAGTTAAA
TTTTTTAAAAAACTAAAGTGACTGGCACTAAGTGAACTTGAGATTATCCTCAGCTTCAAGTTCCTAAGATAAGGGCTTTCTTAAGCTTTC
AGGTGTATGTATCCTCTAGATGTAGACAATAATGTCCCATTTCTAAGTCTTTTCCTTTTGCTTCTCCTTAAATTGATTGTACTTCCAAAT
TTGCTGTTATGTTTTTTTCCTAATACTGTGATCTATCTGATCTGCAGACAAGAACCTTGTCTCTGTTGAAGAGCATCAAGGGGAGATTAT
GTACACATTGAAACTGAAGTGTGGTGTTACTGACGGAATGTGCAGTAACTCCTCAGATATCTGTTAAGGCATTTCCCAGATGTGATGCCA
GCCTTCTTACCTGTACTGAAAGATGCTTAGCTTAGAAAAAAACAAAACAGATGCAAAATCAGATAATTTTATTTTGTTTCATGGGTTTTC
TTATTTACTTTTTAAACAAGGAAGGAATATTAGAAAATCACACAAGGCCTCACATACATGTTATTTAAAGAATGAATTGGGACGGATGTC
TTAGACTTCACTTTCCTAGGCTTTTTAGCAAAACCTAAAGGGTGGTATCCATATTTTGCGTGAATTATGGGTGTAAGACCTTGCCCACTT
AGGTTTTCTATCTCTGTCCTTGATCTTCTTTGCCAAAATGTGAGTATACAGAAATTTTCTGTATATTTCAACTTAAGACATTTTTAGCAT
CTGTATAGTTTGTATTCAATTTGAGACCTTTTCTATGGGAAGCTCAGTAATTTTTATTAAAAGATTGCCATTGCTATTCATGTAAAACAT
GGAAAAAAATTGTGTAGTGAAGCCAACAGTGGACTTAGGATGGGATTGAATGTTCAGTATAGTGATCTCACTTAGGAGAATTTGCAGGAG
AAAGTGATAGTTTATTGTTTTTTCCTCGCCCATATTCAGTTTTGTTCTACTTCCTCCCCTTCCTTCCAGATGATAACATCACATCTCTAC
AGTAAGTGCCTCTGCCAGCCCAACCCAGGAGCGCAAGTTGTCTTTGCCATCTGGTCTATAGTACAGTGCGCGGCGTTAGGCCACAACTCA
AAAGCATTATCTTTTTTAGGGTTAGTAGAAATTGTTTTATGTTGATGGGAGGTTTGTTTGATTGTCAAAATGTACAGCCACAGCCTTTTA
ATTTGGGAGCCCCTGTTGTCATTCAAATGTGTACCTCTACAGTTGTAAAAAGTATTAGATTCTACTATCTGTGGGTTGTGCTTGCCAGAC
AGGTCTTAAATTGTATATTTTTTGGAAAAGTTTATATACTCTCTTAGGAATCATTGTGAAAAGATCAAGAAATCAGGATGGCCATTTATT
TAATATCCATTCATTTCATGTTAGTGGGACTATTAACTTGTCACCAAGCAGGACTCTATTTCAAACAAAATTTAAAACTGTTTGTGGCCT
ATATGTGTTTAATCCTGGTTAAAGATAAAGCTTCATAATGCTGTTTTTATTCAACACATTAACCAGCTGTAAAACACAGACCTTTATCAA
GAGTAGGCAAAGATTTTCAGGATTCATATACAGATAGACTATAAAGTCATGTAATTTGAAAAGCAGTGTTTCATTATGAAAGAGCTCTCA


Top

FusionGenePPI for CENPF_EGLN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CENPFTOP3B, CENPF, ALK, NPM1, TERF1, TERF2, NDEL1, SVIL, ARRB2, SIRT7, COPS6, NUP107, NUP133, NQO2, HECW2, CUL7, OBSL1, CCDC68, FNTB, RNF166, MYC, NFKBIA, POLH, G3BP1, CDCA5, MZT1, CENPU, NANOG, CCDC33, IKBKG, TCP10L, GOPC, FAM167A, FBXL5, COG6, TMA16, ESAM, WASF3, MAP7D2, BRCA1EGLN1POLR2A, ING4, OSR1, HIF1A, EPAS1, HIST1H3A, OS9, SIAH2, EGLN1, EGLN3, SPRY2, SRC, FKBP8, LIMD1, VHL, MAGEA11, MAGEA9, PKM, KRAS, ZNF281, FKBP5, PLD1, RFPL4B, PEX19, SNUPN, CBWD1, CBWD2, MKS1, PLD2, GPLD1, RHOBTB3, PTGES3, FKBP4, HSP90AA1, HSP90AB1, N6AMT2, AKT1, AKT2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7202122_24473563115NDE1 and NDEL1
HgeneCENPFchr1:214795624chr1:231509845ENST00000366955+7201_4813563115SNAP25 and required for localization to the cytoplasm


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CENPF_EGLN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneEGLN1Q9GZT9DB01592IronEgl nine homolog 1small moleculeapproved
TgeneEGLN1Q9GZT9DB00126Vitamin CEgl nine homolog 1small moleculeapproved|nutraceutical

Top

RelatedDiseases for CENPF_EGLN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCENPFC1458155Mammary Neoplasms1CTD_human
TgeneEGLN1C1853286Erythrocytosis, Familial, 32CTD_human;UNIPROT