FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6669

FusionGeneSummary for CDS1_UGT1A7

check button Fusion gene summary
Fusion gene informationFusion gene name: CDS1_UGT1A7
Fusion gene ID: 6669
HgeneTgene
Gene symbol

CDS1

UGT1A7

Gene ID

11200

54577

Gene namecheckpoint kinase 2UDP glucuronosyltransferase family 1 member A7
SynonymsCDS1|CHK2|HuCds1|LFS2|PP1425|RAD53|hCds1UDPGT|UDPGT 1-7|UGT-1G|UGT1-07|UGT1.7|UGT1G
Cytomap

22q12.1

2q37.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase Chk2CHK2 checkpoint homologcds1 homologcheckpoint-like protein CHK2UDP-glucuronosyltransferase 1-7UDP glucuronosyltransferase 1 family, polypeptide A7UDP glycosyltransferase 1 family, polypeptide A7UDP-glucuronosyltransferase 1 family polypeptide A7sUDP-glucuronosyltransferase 1-GUDP-glucuronosyltransferase 1A7
Modification date2018052720180523
UniProtAcc

Q92903

Q9HAW7

Ensembl transtripts involved in fusion geneENST00000295887, ENST00000373426, 
Fusion gene scores* DoF score10 X 2 X 2=402 X 1 X 2=4
# samples 22
** MAII scorelog2(2/40*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: CDS1 [Title/Abstract] AND UGT1A7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDS1

GO:0006355

regulation of transcription, DNA-templated

12717439

HgeneCDS1

GO:0006468

protein phosphorylation

12717439

HgeneCDS1

GO:0006974

cellular response to DNA damage stimulus

24550317

HgeneCDS1

GO:0008630

intrinsic apoptotic signaling pathway in response to DNA damage

12402044

HgeneCDS1

GO:0042770

signal transduction in response to DNA damage

14744935

HgeneCDS1

GO:0045893

positive regulation of transcription, DNA-templated

17101782

HgeneCDS1

GO:0046777

protein autophosphorylation

16794575|18644861

HgeneCDS1

GO:0050821

protein stabilization

12717439

TgeneUGT1A7

GO:0052695

cellular glucuronidation

17179145

TgeneUGT1A7

GO:0052696

flavonoid glucuronidation

20056724

TgeneUGT1A7

GO:0052697

xenobiotic glucuronidation

20056724


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-2F-A9KW-01ACDS1chr4

85530678

+UGT1A7chr2

234675680

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000295887ENST00000373426CDS1chr4

85530678

+UGT1A7chr2

234675680

+

Top

FusionProtFeatures for CDS1_UGT1A7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDS1

Q92903

UGT1A7

Q9HAW7

Provides CDP-diacylglycerol, an important precursor forthe synthesis of phosphatidylinositol (PtdIns),phosphatidylglycerol, and cardiolipin. Overexpression may amplifycellular signaling responses from cytokines. May also play animportant role in the signal transduction mechanism of retina andneural cells. UDPGT is of major importance in the conjugation andsubsequent elimination of potentially toxic xenobiotics andendogenous compounds. Isoform 2 lacks transferase activity butacts as a negative regulator of isoform 1.{ECO:0000269|PubMed:23360619}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+31396_116114462TransmembraneHelical
TgeneUGT1A7chr4:85530678chr2:234675680ENST00000373426+05488_504285531TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+313149_169114462TransmembraneHelical
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+313183_203114462TransmembraneHelical
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+313230_250114462TransmembraneHelical
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+313279_299114462TransmembraneHelical
HgeneCDS1chr4:85530678chr2:234675680ENST00000295887+313357_377114462TransmembraneHelical


Top

FusionGeneSequence for CDS1_UGT1A7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDS1_ENST00000295887_chr4_85530678_+_UGT1A7_ENST00000373426_chr2_234675680_+_360aa
MLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPEIPPSSDRTPEILKKALSGLSSRWKNWWIRG
ILTLTMISLFFLIIYMGSFMLMLLEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKW
LPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLS
SLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTHX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDS1_ENST00000295887_chr4_85530678_+_UGT1A7_ENST00000373426_chr2_234675680_+_1080nt
ATGTTGGAGCTGAGGCACCGGGGAAGCTGCCCCGGCCCCAGGGAAGCGGTGTCGCCGCCACACCGCGAGGGAGAGGCGGCCGGCGGCGAC
CACGAAACCGAGAGCACCAGCGACAAAGAAACAGATATTGATGACAGATATGGAGATTTGGATTCCAGAACAGATTCTGATATTCCGGAA
ATTCCACCATCCTCAGATAGAACCCCTGAGATTCTCAAAAAAGCTCTATCTGGTTTATCTTCAAGGTGGAAAAACTGGTGGATACGTGGA
ATTCTCACTCTAACTATGATCTCGTTGTTTTTCCTGATCATCTATATGGGATCCTTCATGCTGATGCTTCTTGAATTTGAAGCCTACATT
AATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGAT
GCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAATCTTGCGAACAACACGATACTTGTTAAGTGG
CTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAAT
GGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAAT
GTTCTGGAAATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCC
AGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGGCGCGCCACACCTG
CGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTC
ATCACCTTTAAATGTTGTGCTTATGGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDS1_ENST00000295887_chr4_85530678_+_UGT1A7_ENST00000373426_chr2_234675680_+_2243nt
GCGGGGCGGGAGGGGCCTGCGCGGCGGCGGGAGCCCAGAGCCGCGCTAAAGCGGGTCAAGCGTCCTCCTTTTCTCCCCGCCCCTTCTCCT
CCTCCTACCTGGGCCTCTGCGTGGAGACGCGCACCTGGCAACCGGAGGCCGCGTCTCCGCCTTCTCTGCTCGCGCCTGGCGCCCGGAGCC
TGCCCGGGACCTCCGCCGGAGCCGCGCTCGCTGCAGGCGGCCTCGAGCGCTCTCTCGTTGATGCCGTTTTGGAGGTGACCGGCGCGGCGG
CCGCTCTATGGTGGGGCCGCGTTAGTGGCTGCGGCTCCGCGGGACTCCAGGGCGCGGCTGCGAGGTGGCGGGGCGCCCCGCCTGCAGAAC
CCTGCTTGCAGCTCAGGTTTCGGGGTGCTTGAGGAGGCCGCCACGGCAGCGCGGGAGCGGAAGATGTTGGAGCTGAGGCACCGGGGAAGC
TGCCCCGGCCCCAGGGAAGCGGTGTCGCCGCCACACCGCGAGGGAGAGGCGGCCGGCGGCGACCACGAAACCGAGAGCACCAGCGACAAA
GAAACAGATATTGATGACAGATATGGAGATTTGGATTCCAGAACAGATTCTGATATTCCGGAAATTCCACCATCCTCAGATAGAACCCCT
GAGATTCTCAAAAAAGCTCTATCTGGTTTATCTTCAAGGTGGAAAAACTGGTGGATACGTGGAATTCTCACTCTAACTATGATCTCGTTG
TTTTTCCTGATCATCTATATGGGATCCTTCATGCTGATGCTTCTTGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTG
GTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTC
CTGTGGCGGTACACTGGAACCCGACCATCGAATCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCAC
CCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTG
TTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGAAATGACTTCTGAAGATTTA
GAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAG
CCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGG
TACCAGTACCATTCCTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGC
TACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGAGAAGTGGGTGGGAAATAAGGTAAAATT
TTGAACCATTCCCTAGTCATTTCCAAACTTGAAAACAGAATCAGTGTTAAATTCATTTTATTCTTATTAAGGAAATACTTTGCATAAATT
AATCAGCCCCAGAGTGCTTTAAAAAATTCTCTTAAATAAAAATAATAGACTCGCTAGTCAGTAAAGATATTTGAATATGTATCGTGCCCC
CTCTGGTGTCTTTGATCAGGATGACATGTGCCATTTTTCAGAGGACGTGCAGACAGGCTGGCATTCTAGATTACTTTTCTTACTCTGAAA
CATGGCCTGTTTGGGAGTGCGGGATTCAAAGGTGGTCCCACGGCTGCCCCTACTGCAAATGGCAGTTTTAATCTTATCTTTTGGCTTCTG
CAGATGGTTGCAATTGATCCTTAACCAATAATGGTCAGTCCTCATCTCTGTCGTGCTTCATAGGTGCCACCTTGTGTGTTTAAAGAAGGG
AAGCTTTGTACCTTTAGAGTGTAGGTGAAATGAATGAATGGCTTGGAGTGCACTGAGAACAGCATATGATTTCTTGCTTTGGGGAAAAAG
AATGATGCTATGAAATTGGTGGGTGGTGTATTTGAGAAGATAATCATTGCTTATGTCAAATGGAGCTGAATTTGATAAAAACCCAAAATA


Top

FusionGenePPI for CDS1_UGT1A7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDS1CDC25C, VSIG2, MUC15, SCN2B, VSIG1, SNX27, YIPF3, VIPR2, SLC22A9, REEP6, TSPAN6, GRPR, ITGB1UGT1A7UGT1A10, UGT1A9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDS1_UGT1A7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDS1_UGT1A7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCDS1C0024667Animal Mammary Neoplasms1CTD_human
HgeneCDS1C0024668Mammary Neoplasms, Experimental1CTD_human
HgeneCDS1C4277682Chemical and Drug Induced Liver Injury1CTD_human