FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6645

FusionGeneSummary for CDKN2B_DGKD

check button Fusion gene summary
Fusion gene informationFusion gene name: CDKN2B_DGKD
Fusion gene ID: 6645
HgeneTgene
Gene symbol

CDKN2B

DGKD

Gene ID

1030

8527

Gene namecyclin dependent kinase inhibitor 2Bdiacylglycerol kinase delta
SynonymsCDK4I|INK4B|MTS2|P15|TP15|p15INK4bDGKdelta|dgkd-2
Cytomap

9p21.3

2q37.1

Type of geneprotein-codingprotein-coding
Descriptioncyclin-dependent kinase 4 inhibitor BCDK inhibitory proteinCDK4B inhibitorMTS-2cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)cyclin-dependent kinases 4 and 6 binding proteinmultiple tumor suppressor 2p14-INK4bp14_CDK inhibitorp14_INK4Bdiacylglycerol kinase deltaDAG kinase deltaDGK-deltadiacylglycerol kinase, delta 130kDadiglyceride kinase delta
Modification date2018052720180519
UniProtAcc

P42772

Q16760

Ensembl transtripts involved in fusion geneENST00000276925, ENST00000380142, 
ENST00000539462, 
ENST00000264057, 
ENST00000409813, ENST00000489613, 
Fusion gene scores* DoF score1 X 1 X 1=13 X 3 X 3=27
# samples 16
** MAII scorelog2(1/1*10)=3.32192809488736log2(6/27*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CDKN2B [Title/Abstract] AND DGKD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDKN2B

GO:0000079

regulation of cyclin-dependent protein serine/threonine kinase activity

8078588

HgeneCDKN2B

GO:0042326

negative regulation of phosphorylation

8078588

TgeneDGKD

GO:0010033

response to organic substance

12200442

TgeneDGKD

GO:0051260

protein homooligomerization

12200442


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0155-01BCDKN2Bchr9

22008797

-DGKDchr2

234296903

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000276925ENST00000264057CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
Frame-shitENST00000276925ENST00000409813CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
5CDS-3UTRENST00000276925ENST00000489613CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3CDSENST00000380142ENST00000264057CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3CDSENST00000380142ENST00000409813CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3UTRENST00000380142ENST00000489613CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3CDSENST00000539462ENST00000264057CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3CDSENST00000539462ENST00000409813CDKN2Bchr9

22008797

-DGKDchr2

234296903

+
intron-3UTRENST00000539462ENST00000489613CDKN2Bchr9

22008797

-DGKDchr2

234296903

+

Top

FusionProtFeatures for CDKN2B_DGKD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDKN2B

P42772

DGKD

Q16760

Interacts strongly with CDK4 and CDK6. Potent inhibitor.Potential effector of TGF-beta induced cell cycle arrest. May function as signaling molecule.{ECO:0000269|PubMed:17880279}. Isoform 2 may be involved in cell growth andtumorigenesis. Involved in clathrin-dependent endocytosis.{ECO:0000269|PubMed:17880279}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000276925-1213_3952139RepeatNote=ANK 1%3B truncated
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+0298_36-271171Compositional biasNote=Pro-rich
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+0301145_1208521215DomainSAM
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+030317_451521215DomainDAGKc
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+03053_146521215DomainPH
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+0291145_1208-271171DomainSAM
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+029317_451-271171DomainDAGKc
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+02953_146-271171DomainPH
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+030163_213521215Zinc fingerPhorbol-ester/DAG-type 1
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+030235_286521215Zinc fingerPhorbol-ester/DAG-type 2
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+029163_213-271171Zinc fingerPhorbol-ester/DAG-type 1
TgeneDGKDchr9:22008797chr2:234296903ENST00000409813+029235_286-271171Zinc fingerPhorbol-ester/DAG-type 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000276925-12112_13852139RepeatNote=ANK 4
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000276925-1246_7452139RepeatNote=ANK 2
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000276925-1279_10852139RepeatNote=ANK 3
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000380142-12112_138-10779RepeatNote=ANK 4
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000380142-1213_39-10779RepeatNote=ANK 1%3B truncated
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000380142-1246_74-10779RepeatNote=ANK 2
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000380142-1279_108-10779RepeatNote=ANK 3
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000539462-11112_138079RepeatNote=ANK 4
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000539462-1113_39079RepeatNote=ANK 1%3B truncated
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000539462-1146_74079RepeatNote=ANK 2
HgeneCDKN2Bchr9:22008797chr2:234296903ENST00000539462-1179_108079RepeatNote=ANK 3
TgeneDGKDchr9:22008797chr2:234296903ENST00000264057+0308_36521215Compositional biasNote=Pro-rich


Top

FusionGeneSequence for CDKN2B_DGKD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDKN2B_ENST00000276925_chr9_22008797_-_DGKD_ENST00000264057_chr2_234296903_+_1215aa
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYTAKTAKS
IIFDEVDLTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWC
KAMVHTSCKESLLTKCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMA
YEAKLPRQASSSTVTEDFSEDSEVQQILFTEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKATEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKA
VDEQNAQTQEQEGFVLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLETYTEKCVMNNTFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWTGVLGTKELL
HRTYKNLEQKVLLECDGRPIPLPSLQGIAVLNIPSTAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGV
LIHSIREIAQSHRDMEQELAHAVNASSKSMDRVTGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCETKDIFTRHD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDKN2B_ENST00000276925_chr9_22008797_-_DGKD_ENST00000264057_chr2_234296903_+_3645nt
ATGCGCGAGGAGAACAAGGGCATGCCCAGTGGGGGCGGCAGCGATGAGGGTCTGGCCAGCGCCGCGGCGCGGGGACTAGTGGAGAAGGTG
CGACAGCTCCTGGAAGCCGGCGCGGATCCCAACGGAGTCAACCGTTTCGGGAGGCGCGCGATCCAGACCATCATCAAAGAGGGGATGCTG
ACCAAACAGAACAATTCATTCCAGCGATCAAAAAGGAGATACTTTAAGCTTCGAGGGCGAACGCTTTACTATGCCAAAACGGCAAAGTCA
ATCATATTTGATGAGGTGGATCTGACAGATGCCAGCGTAGCTGAATCCAGTACCAAAAACGTCAACAACAGTTTTACGGTCATAACTCCA
TGCAGGAAGCTCATCTTGTGTGCTGATAACAGAAAAGAAATGGAAGATTGGATTGCAGCATTAAAGACTGTGCAGAACAGGGAGCACTTT
GAGCCCACCCAGTACAGCATGGACCACTTCTCAGGGATGCACAATTGGTACGCCTGTTCCCACGCGAGGCCGACCTACTGCAATGTGTGC
CGTGAGGCTCTGTCTGGGGTCACGTCGCACGGGCTGTCCTGCGAGGTGTGCAAATTTAAGGCCCACAAGCGCTGTGCTGTGCGTGCAACC
AATAACTGCAAGTGGACCACACTGGCCTCGATCGGGAAGGACATCATTGAAGATGCAGATGGGATTGCAATGCCCCACCAGTGGTTGGAA
GGAAACCTACCTGTGAGCGCCAAGTGCACTGTGTGCGACAAGACCTGTGGCAGTGTGCTGCGCCTGCAGGACTGGCGCTGCCTCTGGTGC
AAGGCCATGGTTCACACATCGTGTAAAGAATCCTTGCTGACCAAGTGCCCACTTGGCCTGTGCAAAGTGTCAGTCATCCCACCCACGGCT
CTCAACAGCATCGACTCCGATGGGTTCTGGAAGGCCAGCTGTCCTCCTTCTTGCACAAGCCCACTGTTGGTCTTCGTCAATTCAAAAAGT
GGGGACAACCAGGGTGTGAAGTTCCTCAGAAGATTCAAACAGCTACTAAACCCCGCCCAGGTCTTCGACCTCATGAACGGAGGCCCACAC
CTCGGCTTACGGTTATTCCAGAAGTTTGACACATTCCGGATTCTGGTTTGTGGCGGGGATGGAAGTGTTGGCTGGGTCCTCTCCGAAATC
GACAGCCTCAACCTTCATAAACAGTGTCAGCTGGGAGTGCTGCCGCTCGGCACAGGGAACGACTTGGCCCGAGTACTGGGCTGGGGCTCA
GCCTGCGATGACGACACCCAGCTCCCCCAGATCTTGGAGAAGTTGGAGAGAGCCAGCACCAAGATGCTGGACAGGTGGAGCGTCATGGCA
TACGAGGCCAAGCTCCCCCGGCAGGCCTCCTCCTCTACCGTCACCGAAGACTTCAGCGAGGATTCCGAGGTACAGCAGATTCTCTTCTAT
GAAGACTCGGTTGCAGCCCACCTTTCTAAAATCCTCACCTCGGACCAGCACTCGGTGGTCATCTCCTCGGCCAAAGTGCTCTGTGAGACG
GTGAAGGACTTCGTGGCACGGGTGGGGAAGGCCTATGAGAAGACGACCGAGAGCTCGGAGGAGTCAGAGGTCATGGCCAAGAAGTGCTCT
GTCCTGAAAGAGAAGCTGGATTCCCTTCTCAAGACCTTGGACGATGAGTCCCAGGCCTCGTCCTCTCTGCCCAACCCGCCCCCCACCATT
GCCGAGGAGGCTGAAGATGGAGATGGGTCGGGCAGCATCTGCGGTTCCACCGGAGACCGCTTGGTGGCATCAGCTTGCCCGGCCCGGCCG
CAGATATTCCGGCCTCGAGAACAGCTCATGCTGAGAGCCAACAGCCTGAAGAAAGCAATTCGTCAGATCATAGAACACACAGAAAAAGCT
GTCGATGAGCAGAATGCCCAGACCCAGGAGCAGGAGGGCTTCGTCCTGGGCCTCTCTGAGTCAGAGGAGAAGATGGACCACAGAGTGTGC
CCACCACTGTCCCACAGCGAGAGCTTCGGGGTCCCCAAGGGGAGGAGCCAGCGCAAAGTGTCGAAATCTCCGTGTGAAAAGCTGATCAGC
AAAGGGAGTCTGTCCCTAGGCAGTTCTGCTTCCCTTCCGCCCCAGCCGGGAAGCCGGGACGGCCTGCCTGCGCTCAACACCAAGATCCTG
TACCCAAATGTCCGGGCTGGAATGTCTGGTTCCTTACCCGGTGGCTCAGTCATCAGTCGCCTGTTAATTAATGCTGATCCCTTCAACTCT
GAACCAGAAACCCTAGAGTATTACACGGAGAAATGTGTCATGAACAACTATTTTGGCATTGGCCTGGATGCGAAGATATCCCTGGACTTT
AACAACAAGCGCGATGAGCACCCAGAGAAGTGCAGGAGCCGAACCAAGAACATGATGTGGTATGGAGTTCTTGGAACCAAAGAGTTGCTG
CACAGAACCTACAAGAACCTGGAGCAAAAGGTCTTGCTGGAGTGTGACGGGCGACCCATCCCACTCCCCAGTCTTCAGGGAATTGCTGTC
CTTAACATTCCCAGCTATGCCGGAGGAACCAACTTCTGGGGGGGTACCAAGGAAGATGATACTTTCGCAGCTCCATCATTCGATGACAAG
ATTCTGGAGGTGGTCGCCGTGTTCGGCAGCATGCAGATGGCCGTCTCTCGAGTCATCAGGCTACAGCATCATCGGATCGCCCAGTGTCGC
ACGGTGAAGATCTCCATCCTTGGGGATGAGGGCGTGCCTGTGCAGGTGGACGGAGAGGCCTGGGTCCAGCCGCCAGGGTACATTCGGATT
GTCCACAAGAACCGGGCACAGACACTGACCAGAGACAGGGCATTTGAGAGCACCCTGAAGTCCTGGGAAGACAAGCAGAAGTGCGAGCTG
CCCCGCCCTCCATCCTGTTCCCTGCACCCGGAGATGCTGTCCGAGGAGGAGGCCACCCAGATGGACCAGTTTGGGCAGGCAGCAGGGGTC
CTCATTCACAGTATCCGAGAAATAGCTCAGTCTCACCGGGACATGGAGCAGGAACTGGCCCACGCCGTCAATGCCAGCTCCAAGTCCATG
GACCGTGTGTATGGCAAGCCCAGAACCACAGAGGGGCTCAACTGCAGCTTCGTCCTGGAAATGGTGAATAACTTCAGAGCTCTGCGCAGT
GAGACGGAGCTGCTGCTGTCTGGGAAGATGGCCCTGCAGCTGGATCCGCCTCAGAAGGAGCAGCTGGGGAGTGCTCTTGCCGAGATGGAC
CGACAGCTCAGGAGGCTGGCAGACACCCCGTGGCTCTGCCAGTCCGCAGAGCCCGGCGACGAAGAGAGTGTGATGCTGGATCTTGCCAAG
CGCAGTCGCAGTGGTAAATTCCGCCTCGTGACCAAGTTTAAAAAGGAGAAAAACAACAAGAACAAAGAAGCTCACAGTAGCCTGGGAGCC
CCGGTTCACCTCTGGGGGACAGAGGAGGTTGCTGCCTGGCTGGAGCACCTCAGTCTCTGTGAGTATAAGGACATCTTCACACGGCACGAC
ATCCGGGGCTCTGAGCTCCTGCACCTGGAGCGGAGGGACCTCAAGGACCTGGGCGTGACCAAGGTGGGCCACATGAAGAGGATCCTGTGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDKN2B_ENST00000276925_chr9_22008797_-_DGKD_ENST00000264057_chr2_234296903_+_6695nt
GGGAGACGCCGGCCCCTTGGCCCAGCTGAAAACGGAATTCTTTGCCGGCTGGCTCCCCACTCTGCCAGAGCGAGGCGGGGCAGTGAGGAC
TCCGCGACGCGTCCGCACCCTGCGGCCAGAGCGGCTTTGAGCTCGGCTGCGTCCGCGCTAGGCGCTTTTTCCCAGAAGCAATCCAGGCGC
GCCCGCTGGTTCTTGAGCGCCAGGAAAAGCCCGGAGCTAACGACCGGCCGCTCGGCCACTGCACGGGGCCCCAAGCCGCAGAAGGACGAC
GGGAGGGTAATGAAGCTGAGCCCAGGTCTCCTAGGAAGGAGAGAGTGCGCCGGAGCAGCGTGGGAAAGAAGGGAAGAGTGTCGTTAAGTT
TACGGCCAACGGTGGATTATCCGGGCCGCTGCGCGTCTGGGGGCTGCGGAATGCGCGAGGAGAACAAGGGCATGCCCAGTGGGGGCGGCA
GCGATGAGGGTCTGGCCAGCGCCGCGGCGCGGGGACTAGTGGAGAAGGTGCGACAGCTCCTGGAAGCCGGCGCGGATCCCAACGGAGTCA
ACCGTTTCGGGAGGCGCGCGATCCAGACCATCATCAAAGAGGGGATGCTGACCAAACAGAACAATTCATTCCAGCGATCAAAAAGGAGAT
ACTTTAAGCTTCGAGGGCGAACGCTTTACTATGCCAAAACGGCAAAGTCAATCATATTTGATGAGGTGGATCTGACAGATGCCAGCGTAG
CTGAATCCAGTACCAAAAACGTCAACAACAGTTTTACGGTCATAACTCCATGCAGGAAGCTCATCTTGTGTGCTGATAACAGAAAAGAAA
TGGAAGATTGGATTGCAGCATTAAAGACTGTGCAGAACAGGGAGCACTTTGAGCCCACCCAGTACAGCATGGACCACTTCTCAGGGATGC
ACAATTGGTACGCCTGTTCCCACGCGAGGCCGACCTACTGCAATGTGTGCCGTGAGGCTCTGTCTGGGGTCACGTCGCACGGGCTGTCCT
GCGAGGTGTGCAAATTTAAGGCCCACAAGCGCTGTGCTGTGCGTGCAACCAATAACTGCAAGTGGACCACACTGGCCTCGATCGGGAAGG
ACATCATTGAAGATGCAGATGGGATTGCAATGCCCCACCAGTGGTTGGAAGGAAACCTACCTGTGAGCGCCAAGTGCACTGTGTGCGACA
AGACCTGTGGCAGTGTGCTGCGCCTGCAGGACTGGCGCTGCCTCTGGTGCAAGGCCATGGTTCACACATCGTGTAAAGAATCCTTGCTGA
CCAAGTGCCCACTTGGCCTGTGCAAAGTGTCAGTCATCCCACCCACGGCTCTCAACAGCATCGACTCCGATGGGTTCTGGAAGGCCAGCT
GTCCTCCTTCTTGCACAAGCCCACTGTTGGTCTTCGTCAATTCAAAAAGTGGGGACAACCAGGGTGTGAAGTTCCTCAGAAGATTCAAAC
AGCTACTAAACCCCGCCCAGGTCTTCGACCTCATGAACGGAGGCCCACACCTCGGCTTACGGTTATTCCAGAAGTTTGACACATTCCGGA
TTCTGGTTTGTGGCGGGGATGGAAGTGTTGGCTGGGTCCTCTCCGAAATCGACAGCCTCAACCTTCATAAACAGTGTCAGCTGGGAGTGC
TGCCGCTCGGCACAGGGAACGACTTGGCCCGAGTACTGGGCTGGGGCTCAGCCTGCGATGACGACACCCAGCTCCCCCAGATCTTGGAGA
AGTTGGAGAGAGCCAGCACCAAGATGCTGGACAGGTGGAGCGTCATGGCATACGAGGCCAAGCTCCCCCGGCAGGCCTCCTCCTCTACCG
TCACCGAAGACTTCAGCGAGGATTCCGAGGTACAGCAGATTCTCTTCTATGAAGACTCGGTTGCAGCCCACCTTTCTAAAATCCTCACCT
CGGACCAGCACTCGGTGGTCATCTCCTCGGCCAAAGTGCTCTGTGAGACGGTGAAGGACTTCGTGGCACGGGTGGGGAAGGCCTATGAGA
AGACGACCGAGAGCTCGGAGGAGTCAGAGGTCATGGCCAAGAAGTGCTCTGTCCTGAAAGAGAAGCTGGATTCCCTTCTCAAGACCTTGG
ACGATGAGTCCCAGGCCTCGTCCTCTCTGCCCAACCCGCCCCCCACCATTGCCGAGGAGGCTGAAGATGGAGATGGGTCGGGCAGCATCT
GCGGTTCCACCGGAGACCGCTTGGTGGCATCAGCTTGCCCGGCCCGGCCGCAGATATTCCGGCCTCGAGAACAGCTCATGCTGAGAGCCA
ACAGCCTGAAGAAAGCAATTCGTCAGATCATAGAACACACAGAAAAAGCTGTCGATGAGCAGAATGCCCAGACCCAGGAGCAGGAGGGCT
TCGTCCTGGGCCTCTCTGAGTCAGAGGAGAAGATGGACCACAGAGTGTGCCCACCACTGTCCCACAGCGAGAGCTTCGGGGTCCCCAAGG
GGAGGAGCCAGCGCAAAGTGTCGAAATCTCCGTGTGAAAAGCTGATCAGCAAAGGGAGTCTGTCCCTAGGCAGTTCTGCTTCCCTTCCGC
CCCAGCCGGGAAGCCGGGACGGCCTGCCTGCGCTCAACACCAAGATCCTGTACCCAAATGTCCGGGCTGGAATGTCTGGTTCCTTACCCG
GTGGCTCAGTCATCAGTCGCCTGTTAATTAATGCTGATCCCTTCAACTCTGAACCAGAAACCCTAGAGTATTACACGGAGAAATGTGTCA
TGAACAACTATTTTGGCATTGGCCTGGATGCGAAGATATCCCTGGACTTTAACAACAAGCGCGATGAGCACCCAGAGAAGTGCAGGAGCC
GAACCAAGAACATGATGTGGTATGGAGTTCTTGGAACCAAAGAGTTGCTGCACAGAACCTACAAGAACCTGGAGCAAAAGGTCTTGCTGG
AGTGTGACGGGCGACCCATCCCACTCCCCAGTCTTCAGGGAATTGCTGTCCTTAACATTCCCAGCTATGCCGGAGGAACCAACTTCTGGG
GGGGTACCAAGGAAGATGATACTTTCGCAGCTCCATCATTCGATGACAAGATTCTGGAGGTGGTCGCCGTGTTCGGCAGCATGCAGATGG
CCGTCTCTCGAGTCATCAGGCTACAGCATCATCGGATCGCCCAGTGTCGCACGGTGAAGATCTCCATCCTTGGGGATGAGGGCGTGCCTG
TGCAGGTGGACGGAGAGGCCTGGGTCCAGCCGCCAGGGTACATTCGGATTGTCCACAAGAACCGGGCACAGACACTGACCAGAGACAGGG
CATTTGAGAGCACCCTGAAGTCCTGGGAAGACAAGCAGAAGTGCGAGCTGCCCCGCCCTCCATCCTGTTCCCTGCACCCGGAGATGCTGT
CCGAGGAGGAGGCCACCCAGATGGACCAGTTTGGGCAGGCAGCAGGGGTCCTCATTCACAGTATCCGAGAAATAGCTCAGTCTCACCGGG
ACATGGAGCAGGAACTGGCCCACGCCGTCAATGCCAGCTCCAAGTCCATGGACCGTGTGTATGGCAAGCCCAGAACCACAGAGGGGCTCA
ACTGCAGCTTCGTCCTGGAAATGGTGAATAACTTCAGAGCTCTGCGCAGTGAGACGGAGCTGCTGCTGTCTGGGAAGATGGCCCTGCAGC
TGGATCCGCCTCAGAAGGAGCAGCTGGGGAGTGCTCTTGCCGAGATGGACCGACAGCTCAGGAGGCTGGCAGACACCCCGTGGCTCTGCC
AGTCCGCAGAGCCCGGCGACGAAGAGAGTGTGATGCTGGATCTTGCCAAGCGCAGTCGCAGTGGTAAATTCCGCCTCGTGACCAAGTTTA
AAAAGGAGAAAAACAACAAGAACAAAGAAGCTCACAGTAGCCTGGGAGCCCCGGTTCACCTCTGGGGGACAGAGGAGGTTGCTGCCTGGC
TGGAGCACCTCAGTCTCTGTGAGTATAAGGACATCTTCACACGGCACGACATCCGGGGCTCTGAGCTCCTGCACCTGGAGCGGAGGGACC
TCAAGGACCTGGGCGTGACCAAGGTGGGCCACATGAAGAGGATCCTGTGTGGCATCAAGGAGCTGAGCCGCAGCGCCCCCGCCGTCGAGG
CCTAGCCTCTGTCCTCTCAGCCTGTGGCCTCCACATCCCCGCCGCCGAGGCCTAGCCTCCGCCCTCTCAGCCTGTGGCCTCTGCGCCTCC
TGCCACTGAGGCCCTGGGCAGATGCTGCAGCCCGCCCCCTTCTCATGGTGCTACTTCCTCTGTCAGCTACAGAAAGCCTCCGTGACACCG
TCCACCAGAGCTCTGGGGTCTCGAACATAACAACACAGCTACCTTTGAAACAACACTTTCTCCAGCTCAGAGTCACCTGGGGCACATGTG
TCACGGCCACTCAGCTCTCGCCCGCCTGTGCTGTGGGCCAGGGAATCCAGCGGCGTCTGGCCTCCTGGGCACTGCTTGCCTGGCCTCGTG
CTTGGATTGTCCCGGGGGCTCCTCTCCGTGTGTCCTTCTGTGGCCGCACCGTGTGGCTCCGCCTCCTGGCCCCCAGCCAGTTCTCAGAAA
CGTGGCTGGGGCCCAGCACAGCAGCCTGCAAGGGCCCCTGTTTGTTGATGCAGCTTTTGTTGAACAAAAATCGTGCTCTTTCCTGGTTTG
AAAGTAGCATGGATGTTTCCAGTCTTGTTGATTGTAATTTGACGTGAAGAGAAAAAAAAATTCCTCCTGCGTGAGCCAAGGCAGCGGGTG
CTGTTTCCCAGGCGGGGAGCCCCTCCCTGGGTGTCACAGGGCCTGTGCTCCTCCCTCCTCCATCCTCTCTCCTCCCGCTCCTCCCTCCCC
CCACTGTGGGCTGGGGACGCCTGCCCTTCTGTCTCCGGACGCTCTAGGCGAGTTCAGCTTGGGGTGTGAGTGAGACAGCTTGCCAGCTGC
ATCCCTGCAGACAGAGGATGTGTGTCCACATGAGTGTTTCTGTGTGGGAAATGCTTCCTGGCTCTGGGAAACTTTTTCTGCCCATTCTGT
GGTTCCCAGGGAGCGTGGCCCTGGTGGGCCAGGGGTGGTTTGACCTCTTCAGCCCGTCCGGTGGCCTGGAGGCCGGAGGCTCTCCTGAGT
GTCTGCCCCTGCAGTGGCTTCTTGTCGCCTGCTGCTGGGCGTGATGTCGCTGGAGGTGCTGGCAGGGACTCTGATTTGGTGGTCCGCGCT
GCCCCTGCCCTGCCTCTGTCCTGGCTCTGAACTAGTAGATGATGGTGCCAGAGGGCAGGGAGCTCGCCTGGGGAGAGGGCTGTGCCCCGT
AGGGACAGTGCCCAGGTGAAGGATGCCCCTGGTCCTCCAGGGCACTGACTTTGCCCTTTTTTCCCGTTGATAGTCATGGCTCAGAGGTGC
TTGTAAATGTCTTGGGAAGAGGTTTCTGTAACCCCTGCCCTGGTGTGAGGAGGAAATGGCTCTGGCCTGGCTGCCTGGCCGTGGCTTCTC
TTTGGCTCCCAAAGAGAAGGACAGTGTTGGGAGTATCTGCCGTGGCTTCTCTTTGGCTCCCAAAGAGAAGGACAGTGTTGGGAGTATCTG
CCGGCGCTGTCCAGGTCCTTTAGTCAGCGTCACTCCATCTGATGTGCAGAAGCTGGGCTGCACCTGCGGGGGTGGGCATAGACCGGGCTG
GGTCTGCAGCAGCCCCTGGTCCTGAGCAGGCGGCAGTGAACAGCACTGGCCCACCTCCCACTCACAGCCCCTCTGTCCCCTCTGCAGTGC
ACCCAGGTGGGCCCCTCTGCGTGCCTTTGGGTGCTCCCCTCTCGTGGTCGTTCTGGCCCGAGGCCCTTAGAGTATGGAGGCTGAGCCAGG
CCTTGGGTTTCCCCAGCACAGCCTCCTGTCGCTGCATGCGACGTGTTGGGATTTTTGGATGAAAGACTCTCCCACGCTCTGTTGGTGGAC
TTAGCTGCCTCACTGGAAGTGATGTGGGTGGAAGGTGGTTGTATGTTACCTTTTCCACCTCTCATTGTTTTCCCCAGAACATTGTAGATG
GGGGTTGGCAGAGGGAGAAATAAGCCAGCCACGGCAGTCGCTTGGTTTCCCAGGTGGAATGGGCTAACACAGGAGATGATGGGAACCTGT
CCCGCAGTCCCTGCATGACCATTGGCCCTGCTGGCCTGGCGATGTGGGCATCCTGGGGTTCTTAGGGTCCCAGAACAAGCCCCAGGCAAG
CTGGAACTTGGGTGGGGAGGGGACATGAGGAGGATAAACAGCTGACTGTGGCTTCAAGGACATCAGGGCCACCCCAAGTCCTCAGTGTCC
TACTCCTGGCAAGGAGTTGGGTTTGGATCAAAAGTGTTTAAAATTAATATGTTGTCAGTGATTAGAACAACACTGTTTACATAAAAACCA
TTTTTCTAATTCTAACAAGTTAGAATGTGAGGAAGGAATGAACATGAGTGTTTAGGAACCTGCCCTTTGGTGCTGGGCTGGCGTCCCGCA
CTGGGGTGTCCTCGCTGTCTGGGGGCTGCTCTGCTGCCCCGGCCCAGGTCCCCTTGTGGTGTTGCCAGACGGGCCTCATGGTCTGCTGTG
CAGAGAGAGGCAGGAAGGATCCCTGAAGAGTCTTGGAGAAAAGGTTCTGTGCCCTCAGGTGGGGCTTACCCCCTCGTATTTATAATCTTA
ATTTATATAGTGACCACCGTGGAAACAAACGCCTCTTGTATTGTCATGTACATAGTCCATACCTGAGTGCTGTACATAAGTTGTTCTGTG


Top

FusionGenePPI for CDKN2B_DGKD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDKN2BMAGEA11, CDK4, ARPC3, IKBKAP, CCDC90B, KIAA1377, APP, PYCRL, RNF20, ISL1, TGFB1I1, CDK6, TRAF1, NIF3L1, CCDC33, PIAS2DGKDDGKH, HAX1, IGSF21, DGKD, TNFRSF14, SREK1, FEZ1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDKN2B_DGKD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDKN2B_DGKD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCDKN2BC0017638Glioma2CTD_human
HgeneCDKN2BC0017601Glaucoma1CTD_human
HgeneCDKN2BC0024299Lymphoma1CTD_human
HgeneCDKN2BC1956346Coronary Artery Disease1CTD_human
HgeneCDKN2BC3463824MYELODYSPLASTIC SYNDROME1CTD_human