FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6643

FusionGeneSummary for CDKN2A_SOBP

check button Fusion gene summary
Fusion gene informationFusion gene name: CDKN2A_SOBP
Fusion gene ID: 6643
HgeneTgene
Gene symbol

CDKN2A

SOBP

Gene ID

1029

55084

Gene namecyclin dependent kinase inhibitor 2Asine oculis binding protein homolog
SynonymsARF|CDK4I|CDKN2|CMM2|INK4|INK4A|MLM|MTS-1|MTS1|P14|P14ARF|P16|P16-INK4A|P16INK4|P16INK4A|P19|P19ARF|TP16JXC1|MRAMS
Cytomap

9p21.3

6q21

Type of geneprotein-codingprotein-coding
Descriptioncyclin-dependent kinase inhibitor 2ACDK4 inhibitor p16-INK4alternative reading framecell cycle negative regulator betacyclin-dependent kinase 4 inhibitor Acyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)multiple tumor suppressor 1sine oculis-binding protein homologjackson circler protein 1
Modification date2018052720180519
UniProtAcc

Q8N726

A7XYQ1

Ensembl transtripts involved in fusion geneENST00000361570, ENST00000304494, 
ENST00000579755, ENST00000579122, 
ENST00000578845, ENST00000530628, 
ENST00000498124, ENST00000498628, 
ENST00000494262, ENST00000446177, 
ENST00000479692, ENST00000497750, 
ENST00000470819, 
ENST00000317357, 
ENST00000494935, 
Fusion gene scores* DoF score11 X 4 X 9=3964 X 4 X 3=48
# samples 114
** MAII scorelog2(11/396*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDKN2A [Title/Abstract] AND SOBP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDKN2A

GO:0000082

G1/S transition of mitotic cell cycle

10208428

HgeneCDKN2A

GO:0007050

cell cycle arrest

15149599

HgeneCDKN2A

GO:0008285

negative regulation of cell proliferation

15149599

HgeneCDKN2A

GO:0030308

negative regulation of cell growth

10208428

HgeneCDKN2A

GO:0032088

negative regulation of NF-kappaB transcription factor activity

10353611

HgeneCDKN2A

GO:0042326

negative regulation of phosphorylation

8259215|10208428

HgeneCDKN2A

GO:0045736

negative regulation of cyclin-dependent protein serine/threonine kinase activity

7739547|8259215


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-IN-A6RL-01ACDKN2Achr9

21994138

-SOBPchr6

107908284

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000361570ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
5CDS-intronENST00000361570ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000304494ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000304494ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
In-frameENST00000579755ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
5CDS-intronENST00000579755ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000579122ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000579122ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000578845ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000578845ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
In-frameENST00000530628ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
5CDS-intronENST00000530628ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000498124ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000498124ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000498628ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000498628ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000494262ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000494262ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000446177ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000446177ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000479692ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000479692ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000497750ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000497750ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-3CDSENST00000470819ENST00000317357CDKN2Achr9

21994138

-SOBPchr6

107908284

+
intron-intronENST00000470819ENST00000494935CDKN2Achr9

21994138

-SOBPchr6

107908284

+

Top

FusionProtFeatures for CDKN2A_SOBP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDKN2A

Q8N726

SOBP

A7XYQ1

Capable of inducing cell cycle arrest in G1 and G2phases. Acts as a tumor suppressor. Binds to MDM2 and blocks itsnucleocytoplasmic shuttling by sequestering it in the nucleolus.This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependenttransactivation and apoptosis. Also induces G2 arrest andapoptosis in a p53-independent manner by preventing the activationof cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulatesBCL6-induced transcriptional repression. Binds to E2F1 and MYC andblocks their transcriptional activator activity but has no effecton MYC transcriptional repression. Binds to TOP1/TOPOI andstimulates its activity. This complex binds to rRNA gene promotersand may play a role in rRNA transcription and/or maturation.Interacts with NPM1/B23 and promotes its polyubiquitination anddegradation, thus inhibiting rRNA processing. Interacts withCOMMD1 and promotes its 'Lys63'-linked polyubiquitination.Interacts with UBE2I/UBC9 and enhances sumoylation of a number ofits binding partners including MDM2 and E2F1. Binds to HUWE1 andrepresses its ubiquitin ligase activity. May play a role incontrolling cell proliferation and apoptosis during mammary glanddevelopment. Isoform smARF may be involved in regulation ofautophagy and caspase-independent cell death; the short-livedmitochondrial isoform is stabilized by C1QBP.{ECO:0000269|PubMed:11314011, ECO:0000269|PubMed:11314038,ECO:0000269|PubMed:12660818, ECO:0000269|PubMed:14636574,ECO:0000269|PubMed:15361825, ECO:0000269|PubMed:15567177,ECO:0000269|PubMed:15876874, ECO:0000269|PubMed:15989956,ECO:0000269|PubMed:16713577, ECO:0000269|PubMed:18305112,ECO:0000269|PubMed:22094112, ECO:0000269|PubMed:9724636}. Implicated in development of the cochlea.{ECO:0000250|UniProtKB:Q0P5V2}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSOBPchr9:21994138chr6:107908284ENST00000317357+37346_5521911271Compositional biasPro-rich
TgeneSOBPchr9:21994138chr6:107908284ENST00000317357+37740_7631911271Compositional biasPro-rich
TgeneSOBPchr9:21994138chr6:107908284ENST00000317357+37216_2561911271Zinc fingerFCS-type 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000304494-13110_139-91157RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000304494-1311_40-91157RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000304494-1344_72-91157RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000304494-1377_106-91157RepeatNote=ANK 3
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000446177-13110_139-71168RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000446177-1311_40-71168RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000446177-1344_72-71168RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000446177-1377_106-71168RepeatNote=ANK 3
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000494262-14110_139-208106RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000494262-1411_40-208106RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000494262-1444_72-208106RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000494262-1477_106-208106RepeatNote=ANK 3
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498124-14110_139-13130RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498124-1411_40-13130RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498124-1444_72-13130RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498124-1477_106-13130RepeatNote=ANK 3
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498628-13110_139-162106RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498628-1311_40-162106RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498628-1344_72-162106RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000498628-1377_106-162106RepeatNote=ANK 3
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000578845-12110_139-43106RepeatNote=ANK 4
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000578845-1211_40-43106RepeatNote=ANK 1
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000578845-1244_72-43106RepeatNote=ANK 2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000578845-1277_106-43106RepeatNote=ANK 3
TgeneSOBPchr9:21994138chr6:107908284ENST00000317357+37142_1801911271Zinc fingerFCS-type 1


Top

FusionGeneSequence for CDKN2A_SOBP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDKN2A_ENST00000361570_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_788aa
MGRGRCVGPSLQLRGQEWRCSPLVPKGGAAAAELGPGGGENMVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLML
LRSQRLGQQPLPRRPG_R_RWTC_KFSPAALC_GNSKACLQE_LRTTCM_LV_AHKTHKRIPGFWGRGKKASVLQCKMSQSIQNGHFLQR
DPGQSSSWAVQHITPSHGK_SRRHRGAAAHSRLLETPANRCSEEGPLPGGYSWPKPGPWPVGVHHRLSI_HCQLLCH_NPHASAQVHPHQ
RDSKTPSCLRPATC_HRASPWRPASEPSHGDDQPRPGAAAHLHGAADHAADPPALHPRASAPCLQPQQPPVQPHASRHRAPARWPQKPGP
HFQPHAPAHAIAPHPPPEHPHHAREPPRPAAPAASGRPAAESSLPASEHDAKWPDAGAPDDEFRAAVACPAGAAPDPARAVPRDRAPTGA
HPHPHPTPSRQRLQAPQRVLQQRGELHSERPWRLRGGGRQAKRTLPVPPGLQAGLVQVRGLAPRLLGPGPEPGAHARRAWPERGGGPDAA
RRQPPGPPGRGRPARLPRRAAGPAGRRHRPDRGPPSPAAQRDPPRAARARQGGARAERRGAQDLRRLQGRPLQPARRRRPRPGRPGGPRG
GRGLQRHRERHARRRRRGR_ERGAASRAAAAAAAARAPQEAAVA_GTGGERARVGQGE_LCFQLPPGRGGGQKADGRGGPGGGRQVRPEP

>In-frame_CDKN2A_ENST00000579755_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_747aa
MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPG_R_RWTC_KFSPAALC_GNSKACLQ
E_LRTTCM_LV_AHKTHKRIPGFWGRGKKASVLQCKMSQSIQNGHFLQRDPGQSSSWAVQHITPSHGK_SRRHRGAAAHSRLLETPANRC
SEEGPLPGGYSWPKPGPWPVGVHHRLSI_HCQLLCH_NPHASAQVHPHQRDSKTPSCLRPATC_HRASPWRPASEPSHGDDQPRPGAAAH
LHGAADHAADPPALHPRASAPCLQPQQPPVQPHASRHRAPARWPQKPGPHFQPHAPAHAIAPHPPPEHPHHAREPPRPAAPAASGRPAAE
SSLPASEHDAKWPDAGAPDDEFRAAVACPAGAAPDPARAVPRDRAPTGAHPHPHPTPSRQRLQAPQRVLQQRGELHSERPWRLRGGGRQA
KRTLPVPPGLQAGLVQVRGLAPRLLGPGPEPGAHARRAWPERGGGPDAARRQPPGPPGRGRPARLPRRAAGPAGRRHRPDRGPPSPAAQR
DPPRAARARQGGARAERRGAQDLRRLQGRPLQPARRRRPRPGRPGGPRGGRGLQRHRERHARRRRRGR_ERGAASRAAAAAAAARAPQEA
AVA_GTGGERARVGQGE_LCFQLPPGRGGGQKADGRGGPGGGRQVRPEP__PRGRGPCLCSADAAQDRLRDPACAKTRGEGCHGTVHHLL

>In-frame_CDKN2A_ENST00000530628_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_747aa
MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPG_R_RWTC_KFSPAALC_GNSKACLQ
E_LRTTCM_LV_AHKTHKRIPGFWGRGKKASVLQCKMSQSIQNGHFLQRDPGQSSSWAVQHITPSHGK_SRRHRGAAAHSRLLETPANRC
SEEGPLPGGYSWPKPGPWPVGVHHRLSI_HCQLLCH_NPHASAQVHPHQRDSKTPSCLRPATC_HRASPWRPASEPSHGDDQPRPGAAAH
LHGAADHAADPPALHPRASAPCLQPQQPPVQPHASRHRAPARWPQKPGPHFQPHAPAHAIAPHPPPEHPHHAREPPRPAAPAASGRPAAE
SSLPASEHDAKWPDAGAPDDEFRAAVACPAGAAPDPARAVPRDRAPTGAHPHPHPTPSRQRLQAPQRVLQQRGELHSERPWRLRGGGRQA
KRTLPVPPGLQAGLVQVRGLAPRLLGPGPEPGAHARRAWPERGGGPDAARRQPPGPPGRGRPARLPRRAAGPAGRRHRPDRGPPSPAAQR
DPPRAARARQGGARAERRGAQDLRRLQGRPLQPARRRRPRPGRPGGPRGGRGLQRHRERHARRRRRGR_ERGAASRAAAAAAAARAPQEA
AVA_GTGGERARVGQGE_LCFQLPPGRGGGQKADGRGGPGGGRQVRPEP__PRGRGPCLCSADAAQDRLRDPACAKTRGEGCHGTVHHLL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDKN2A_ENST00000361570_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_2365nt
ATGGGCAGGGGGCGGTGCGTGGGTCCCAGTCTGCAGTTAAGGGGGCAGGAGTGGCGCTGCTCACCTCTGGTGCCAAAGGGCGGCGCAGCG
GCTGCCGAGCTCGGCCCTGGAGGCGGCGAGAACATGGTGCGCAGGTTCTTGGTGACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGA
GTGAGGGTTTTCGTGGTTCACATCCCGCGGCTCACGGGGGAGTGGGCAGCGCCAGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTA
CTGAGGAGCCAGCGTCTAGGGCAGCAGCCGCTTCCTAGAAGACCAGGCTAGAGATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCA
CTATGCTAAGGAAACTCCAAGGCTTGCCTTCAAGAATAACTGCGAACTACTTGTATGTGACTGGTGTAAGCACATAAGACACACAAAAGA
ATACCTGGATTTTGGGGACGGGGAAAGAAGGCTTCAGTTCTGCAGTGCAAAATGTCTCAATCAATACAAAATGGACATTTTCTACAAAGA
GACCCAGGCCAATCTTCCAGCTGGGCTGTGCAGCACATTACACCCTCCCATGGAAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCAC
TCCAGACTCTTGGAATATCCCGCTAACAGATGCTCGGAGGAAGGCCCCCTCCCCGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCC
GTCGGCGTCCACCACCGTCTCTCCATCTGACACTGCCAACTGCTCTGTCACTAAAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAG
CGAGACTCCAAATATCCCTCCTGTCTCCGTCCAGCCACCTGCTAGCATCGGGCCTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGT
GATGACCAACCGCGGCCCGGTGCCGCTGCCCATCTTCATGGAGCAGCAGATCATGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCC
GCACCATGCCTCCAACCCCAACAGCCCCCTGTCCAACCCCATGCTTCCCGGCATCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCC
CACTTCCAGCCCCATGCACCGGCCCATGCTATCGCCCCACATCCACCCCCCGAGCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCT
GCCCCCGCCGCCTCCGGGCGCCCCGCTGCCGAGTCTTCCCTTCCCGCCAGTGAGCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGAT
GATGAATTTCGGGCTGCCGTCGCTTGCCCCGCTGGTGCCGCCCCCGACCCTGCTCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCC
CATCCCCATCCCCATCCCTATCCCTCACGTCAGCGACTCCAAGCCCCCCAACGGGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGC
CCCTGGCGACTCCGCGGCGGCGGGCGGCAAGCCAAGCGGACACTCCCTGTCCCCCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGA
CTCGCCCCCCGGCTGCTCGGGCCAGGCCCTGAGCCTGGCGCCCACGCCCGCCGAGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCG
CGCCGGCAGCCCCCCGGGCCCCCCGGGCGCGGGCGGCCAGCTCGGCTTCCCAGGCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCT
GACCGTGGGCCACCGAGCCCGGCTGCACAACGTGATCCACCGCGCGCTGCACGCGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGA
GCGCAGGACCTGCGGCGGCTGCAGGGACGGCCACTGCAGCCCGCCCGCCGCCGGCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGC
GGCCGCGGCCTGCAACGTCATCGTGAACGGCACGCGCGGCGCCGCCGCCGAGGGCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCC
GCCGCCGCCGCCGCCCGCGCCCCCCAAGAAGCTGCTGTCGCCTGAGGAACCGGCGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTG
TGCTTCCAACTGCCACCTGGACGGGGAGGCGGCCAAAAAGCTGATGGGCGAGGAGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCT
TAATAACCCCGCGGACGAGGACCATGCCTATGCTCTGCGGATGCTGCCCAAGACCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGA
GAAGGCTGCCATGGCACCGTGCATCATCTCCTCGCCCATGCTCAGCGCCGGGCCTGAGGACCTGGAGCCGCCGCTCAAAAGGAGGTGCCT

>In-frame_CDKN2A_ENST00000579755_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_2242nt
ATGGTGCGCAGGTTCTTGGTGACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGAGTGAGGGTTTTCGTGGTTCACATCCCGCGGCTC
ACGGGGGAGTGGGCAGCGCCAGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTACTGAGGAGCCAGCGTCTAGGGCAGCAGCCGCTT
CCTAGAAGACCAGGCTAGAGATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCACTATGCTAAGGAAACTCCAAGGCTTGCCTTCAA
GAATAACTGCGAACTACTTGTATGTGACTGGTGTAAGCACATAAGACACACAAAAGAATACCTGGATTTTGGGGACGGGGAAAGAAGGCT
TCAGTTCTGCAGTGCAAAATGTCTCAATCAATACAAAATGGACATTTTCTACAAAGAGACCCAGGCCAATCTTCCAGCTGGGCTGTGCAG
CACATTACACCCTCCCATGGAAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCACTCCAGACTCTTGGAATATCCCGCTAACAGATGC
TCGGAGGAAGGCCCCCTCCCCGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCCGTCGGCGTCCACCACCGTCTCTCCATCTGACAC
TGCCAACTGCTCTGTCACTAAAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAGCGAGACTCCAAATATCCCTCCTGTCTCCGTCCA
GCCACCTGCTAGCATCGGGCCTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGTGATGACCAACCGCGGCCCGGTGCCGCTGCCCAT
CTTCATGGAGCAGCAGATCATGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCCGCACCATGCCTCCAACCCCAACAGCCCCCTGTC
CAACCCCATGCTTCCCGGCATCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCCCACTTCCAGCCCCATGCACCGGCCCATGCTATC
GCCCCACATCCACCCCCCGAGCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCTGCCCCCGCCGCCTCCGGGCGCCCCGCTGCCGAG
TCTTCCCTTCCCGCCAGTGAGCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGATGATGAATTTCGGGCTGCCGTCGCTTGCCCCGCT
GGTGCCGCCCCCGACCCTGCTCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCCCATCCCCATCCCCATCCCTATCCCTCACGTCAG
CGACTCCAAGCCCCCCAACGGGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGCCCCTGGCGACTCCGCGGCGGCGGGCGGCAAGCC
AAGCGGACACTCCCTGTCCCCCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGACTCGCCCCCCGGCTGCTCGGGCCAGGCCCTGAG
CCTGGCGCCCACGCCCGCCGAGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCGCGCCGGCAGCCCCCCGGGCCCCCCGGGCGCGGG
CGGCCAGCTCGGCTTCCCAGGCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCTGACCGTGGGCCACCGAGCCCGGCTGCACAACGT
GATCCACCGCGCGCTGCACGCGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGAGCGCAGGACCTGCGGCGGCTGCAGGGACGGCCA
CTGCAGCCCGCCCGCCGCCGGCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGCGGCCGCGGCCTGCAACGTCATCGTGAACGGCAC
GCGCGGCGCCGCCGCCGAGGGCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCCGCCGCCGCCGCCGCCCGCGCCCCCCAAGAAGCT
GCTGTCGCCTGAGGAACCGGCGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTGTGCTTCCAACTGCCACCTGGACGGGGAGGCGGC
CAAAAAGCTGATGGGCGAGGAGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCTTAATAACCCCGCGGACGAGGACCATGCCTATGC
TCTGCGGATGCTGCCCAAGACCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGAGAAGGCTGCCATGGCACCGTGCATCATCTCCTC

>In-frame_CDKN2A_ENST00000530628_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_2242nt
ATGGTGCGCAGGTTCTTGGTGACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGAGTGAGGGTTTTCGTGGTTCACATCCCGCGGCTC
ACGGGGGAGTGGGCAGCGCCAGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTACTGAGGAGCCAGCGTCTAGGGCAGCAGCCGCTT
CCTAGAAGACCAGGCTAGAGATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCACTATGCTAAGGAAACTCCAAGGCTTGCCTTCAA
GAATAACTGCGAACTACTTGTATGTGACTGGTGTAAGCACATAAGACACACAAAAGAATACCTGGATTTTGGGGACGGGGAAAGAAGGCT
TCAGTTCTGCAGTGCAAAATGTCTCAATCAATACAAAATGGACATTTTCTACAAAGAGACCCAGGCCAATCTTCCAGCTGGGCTGTGCAG
CACATTACACCCTCCCATGGAAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCACTCCAGACTCTTGGAATATCCCGCTAACAGATGC
TCGGAGGAAGGCCCCCTCCCCGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCCGTCGGCGTCCACCACCGTCTCTCCATCTGACAC
TGCCAACTGCTCTGTCACTAAAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAGCGAGACTCCAAATATCCCTCCTGTCTCCGTCCA
GCCACCTGCTAGCATCGGGCCTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGTGATGACCAACCGCGGCCCGGTGCCGCTGCCCAT
CTTCATGGAGCAGCAGATCATGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCCGCACCATGCCTCCAACCCCAACAGCCCCCTGTC
CAACCCCATGCTTCCCGGCATCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCCCACTTCCAGCCCCATGCACCGGCCCATGCTATC
GCCCCACATCCACCCCCCGAGCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCTGCCCCCGCCGCCTCCGGGCGCCCCGCTGCCGAG
TCTTCCCTTCCCGCCAGTGAGCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGATGATGAATTTCGGGCTGCCGTCGCTTGCCCCGCT
GGTGCCGCCCCCGACCCTGCTCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCCCATCCCCATCCCCATCCCTATCCCTCACGTCAG
CGACTCCAAGCCCCCCAACGGGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGCCCCTGGCGACTCCGCGGCGGCGGGCGGCAAGCC
AAGCGGACACTCCCTGTCCCCCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGACTCGCCCCCCGGCTGCTCGGGCCAGGCCCTGAG
CCTGGCGCCCACGCCCGCCGAGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCGCGCCGGCAGCCCCCCGGGCCCCCCGGGCGCGGG
CGGCCAGCTCGGCTTCCCAGGCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCTGACCGTGGGCCACCGAGCCCGGCTGCACAACGT
GATCCACCGCGCGCTGCACGCGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGAGCGCAGGACCTGCGGCGGCTGCAGGGACGGCCA
CTGCAGCCCGCCCGCCGCCGGCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGCGGCCGCGGCCTGCAACGTCATCGTGAACGGCAC
GCGCGGCGCCGCCGCCGAGGGCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCCGCCGCCGCCGCCGCCCGCGCCCCCCAAGAAGCT
GCTGTCGCCTGAGGAACCGGCGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTGTGCTTCCAACTGCCACCTGGACGGGGAGGCGGC
CAAAAAGCTGATGGGCGAGGAGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCTTAATAACCCCGCGGACGAGGACCATGCCTATGC
TCTGCGGATGCTGCCCAAGACCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGAGAAGGCTGCCATGGCACCGTGCATCATCTCCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDKN2A_ENST00000361570_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_4352nt
CGCTCAGGGAAGGCGGGTGCGCGCCTGCGGGGCGGAGATGGGCAGGGGGCGGTGCGTGGGTCCCAGTCTGCAGTTAAGGGGGCAGGAGTG
GCGCTGCTCACCTCTGGTGCCAAAGGGCGGCGCAGCGGCTGCCGAGCTCGGCCCTGGAGGCGGCGAGAACATGGTGCGCAGGTTCTTGGT
GACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGAGTGAGGGTTTTCGTGGTTCACATCCCGCGGCTCACGGGGGAGTGGGCAGCGCC
AGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTACTGAGGAGCCAGCGTCTAGGGCAGCAGCCGCTTCCTAGAAGACCAGGCTAGAG
ATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCACTATGCTAAGGAAACTCCAAGGCTTGCCTTCAAGAATAACTGCGAACTACTTG
TATGTGACTGGTGTAAGCACATAAGACACACAAAAGAATACCTGGATTTTGGGGACGGGGAAAGAAGGCTTCAGTTCTGCAGTGCAAAAT
GTCTCAATCAATACAAAATGGACATTTTCTACAAAGAGACCCAGGCCAATCTTCCAGCTGGGCTGTGCAGCACATTACACCCTCCCATGG
AAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCACTCCAGACTCTTGGAATATCCCGCTAACAGATGCTCGGAGGAAGGCCCCCTCCC
CGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCCGTCGGCGTCCACCACCGTCTCTCCATCTGACACTGCCAACTGCTCTGTCACTA
AAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAGCGAGACTCCAAATATCCCTCCTGTCTCCGTCCAGCCACCTGCTAGCATCGGGC
CTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGTGATGACCAACCGCGGCCCGGTGCCGCTGCCCATCTTCATGGAGCAGCAGATCA
TGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCCGCACCATGCCTCCAACCCCAACAGCCCCCTGTCCAACCCCATGCTTCCCGGCA
TCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCCCACTTCCAGCCCCATGCACCGGCCCATGCTATCGCCCCACATCCACCCCCCGA
GCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCTGCCCCCGCCGCCTCCGGGCGCCCCGCTGCCGAGTCTTCCCTTCCCGCCAGTGA
GCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGATGATGAATTTCGGGCTGCCGTCGCTTGCCCCGCTGGTGCCGCCCCCGACCCTGC
TCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCCCATCCCCATCCCCATCCCTATCCCTCACGTCAGCGACTCCAAGCCCCCCAACG
GGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGCCCCTGGCGACTCCGCGGCGGCGGGCGGCAAGCCAAGCGGACACTCCCTGTCCC
CCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGACTCGCCCCCCGGCTGCTCGGGCCAGGCCCTGAGCCTGGCGCCCACGCCCGCCG
AGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCGCGCCGGCAGCCCCCCGGGCCCCCCGGGCGCGGGCGGCCAGCTCGGCTTCCCAG
GCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCTGACCGTGGGCCACCGAGCCCGGCTGCACAACGTGATCCACCGCGCGCTGCACG
CGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGAGCGCAGGACCTGCGGCGGCTGCAGGGACGGCCACTGCAGCCCGCCCGCCGCCG
GCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGCGGCCGCGGCCTGCAACGTCATCGTGAACGGCACGCGCGGCGCCGCCGCCGAGG
GCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCCGCCGCCGCCGCCGCCCGCGCCCCCCAAGAAGCTGCTGTCGCCTGAGGAACCGG
CGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTGTGCTTCCAACTGCCACCTGGACGGGGAGGCGGCCAAAAAGCTGATGGGCGAGG
AGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCTTAATAACCCCGCGGACGAGGACCATGCCTATGCTCTGCGGATGCTGCCCAAGA
CCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGAGAAGGCTGCCATGGCACCGTGCATCATCTCCTCGCCCATGCTCAGCGCCGGGC
CTGAGGACCTGGAGCCGCCGCTCAAAAGGAGGTGCCTCCGAATTAGAAATCAGAATAAGTAAAAGGAACGTTCACTCACAGGGTACGCTC
ATGGAGAGAGGGCGCAGAGCAAACCATGTCACGCCATCCAATGACACCAGCTGGTCAGCTCACCACCCCCTCTGGCTAAAACTCAAGCAA
ATAAAGCCGCTTCCTGTCATTAAGCATCTCAGAGGAAGCAGCCCTCCCTCGATGGCCTCTAGCCCAGAGAAGCCCGCGCATCTTGGACCC
ACCAAGCAGGCCCAGCCTTCCTGCTGCCACCATCTCTGCTTCTCCCCAGAGGAACTTAGGGATTTCACCCCTGGCTTTTAAAAAAAACGA
AATACCGACAAGCCACAAGGACCAATGTAGGTATTCTCCCCGCCCCATCTTCAAGGCTCAGCGACTGAGGCTGGAAGATGATATGGATTG
GAACACAAAAAATCTTTTTTTAATCTTTTTAAAAACTGCTGTGGTTTTGCTGCTACACTAAGAATTGTGATTTGCATTGTACGGTTTTGG
ACCTATATTGTTCACGTTTTGATGGCGGAGAGGGGTGGTCCTGGAGGCCCAATGCTTCAGAGTCATCTCTGTCCTGCCCGGGATGCACTT
TTAAATGAAGAGTTAGAATATTTTATTGGCTAATATACTTTTCTTGTTATTTTTACAAAGGCCACCTTTATCCTTTTTGATGCCATATTT
TCAGTGTTACACTTTTATGGCTTTTAATTTTCGATTTGACAGATGTAAGAAGCAGCATGAATAGTTTATACTGTGGTTTTTCAGAGACTG
AATGCCAAGAGAACTCGGTAAATGTTTATTCTTCTCAGCTTTCTCTTTAAATTCCCCTAAATAGCGCCCCATTTGGGAACAGAGCAAGAG
TGTTGAACTGAAGACCAAAATGCCCTCAAGGTGTAAAATAATCCGAGGGGGAATATTTGCTGGGCGTCAGGAAAGACTCAGATGAAATTT
CAACCCTGATGGTTTTCGGTGATCCAGGAAGTCAGTGAGACAATCTCTCTATATGCAGAGCCCTTTCATGATAATTAGAATGGTATGGAC
AAACCAATGAAAACAAGAGGGAAAGTGAGAAAGATCACCCATGATTCTGTTTCACTGTTTGCTTTCTCCTGTCATGGTTAAGAGAAATGT
GCAATTCGATCCTCAATCAGTGGGTGGAGGATAACAGGGTAGATTCACTTGTGTGCACTTGTACAGTTGTAGCTGCGAGTCCAGAAGTCC
TCTAGAGCATGTGTACTGGCACTGAGTTGGTGAGACAGTTGTGGAGTATCCCATTCTGATGAGTACAGAAAAAAAAAGAAAAAGAAAAGA
AGAGAAAAAATTAAGAAAAAAATCAAAAAAGGAAGAAAACTAAAAAAAAAAAAAATCAAATCACCTTGTGATTCAGTGTATCTGTTTACT
AACTCAAATAAAGCAATTGTTCCCTCTGGAGGGGTCCAGGTGCCCCCGCCCCACAAGGCCGCGGAGCCTCAGCAGGAGGGGTGGCGAGTT
GCGGGTGGGCAGGGCCAGGACGGTGTGGCGCCAGCCTTGAAGCACCACGGCCCAAGGATGCGGTGTACATACTGTATTTCTAGATTCTCC
TTTGTACAGAGTCACTTCACAAGTCAAGCTACTGTTTTACAGGTGCTCCTTATTTATTAGAGCTGTGAGAGCTTGGGGGACACACCTGGC
GAGCAAGCTCGCTTTTTAAAAATGAAATTTGGGGGCAGGGGAAGGGGAGGCGGGAGGGAGGGGAAGCTCGCAAGCCCGGGGAGAGATTTA
TAAAAGTAAACAAAAGAAAACCTTCCAGCAACAAATTAAAAAATAATAACAAATCAACCCCAGCACCAAACCCACCCAGGCAGGAAGAAG
CCGCCCCTCCTCTGGGGCCATATTTTTCTGCTGGGTCACAACATTCTCCTCTCCCTGACTGGTGTCAGATTCATCAAACAAAAAATAAAT

>In-frame_CDKN2A_ENST00000579755_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_4485nt
CGCGCGCGCCTCCCTACGGGCGCCTCCGGCAGCCCTTCCCGCGTGCGCAGGGCTCAGAGCCGTTCCGAGATCTTGGAGGTCCGGGTGGGA
GTGGGGGTGGGGTGGGGGTGGGGGTGAAGGTGGGGGGCGGGCGCGCTCAGGGAAGGCGGGTGCGCGCCTGCGGGGCGGAGATGGGCAGGG
GGCGGTGCGTGGGTCCCAGTCTGCAGTTAAGGGGGCAGGAGTGGCGCTGCTCACCTCTGGTGCCAAAGGGCGGCGCAGCGGCTGCCGAGC
TCGGCCCTGGAGGCGGCGAGAACATGGTGCGCAGGTTCTTGGTGACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGAGTGAGGGTTT
TCGTGGTTCACATCCCGCGGCTCACGGGGGAGTGGGCAGCGCCAGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTACTGAGGAGCC
AGCGTCTAGGGCAGCAGCCGCTTCCTAGAAGACCAGGCTAGAGATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCACTATGCTAAG
GAAACTCCAAGGCTTGCCTTCAAGAATAACTGCGAACTACTTGTATGTGACTGGTGTAAGCACATAAGACACACAAAAGAATACCTGGAT
TTTGGGGACGGGGAAAGAAGGCTTCAGTTCTGCAGTGCAAAATGTCTCAATCAATACAAAATGGACATTTTCTACAAAGAGACCCAGGCC
AATCTTCCAGCTGGGCTGTGCAGCACATTACACCCTCCCATGGAAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCACTCCAGACTCT
TGGAATATCCCGCTAACAGATGCTCGGAGGAAGGCCCCCTCCCCGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCCGTCGGCGTCC
ACCACCGTCTCTCCATCTGACACTGCCAACTGCTCTGTCACTAAAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAGCGAGACTCCA
AATATCCCTCCTGTCTCCGTCCAGCCACCTGCTAGCATCGGGCCTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGTGATGACCAAC
CGCGGCCCGGTGCCGCTGCCCATCTTCATGGAGCAGCAGATCATGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCCGCACCATGCC
TCCAACCCCAACAGCCCCCTGTCCAACCCCATGCTTCCCGGCATCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCCCACTTCCAGC
CCCATGCACCGGCCCATGCTATCGCCCCACATCCACCCCCCGAGCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCTGCCCCCGCCG
CCTCCGGGCGCCCCGCTGCCGAGTCTTCCCTTCCCGCCAGTGAGCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGATGATGAATTTC
GGGCTGCCGTCGCTTGCCCCGCTGGTGCCGCCCCCGACCCTGCTCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCCCATCCCCATC
CCCATCCCTATCCCTCACGTCAGCGACTCCAAGCCCCCCAACGGGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGCCCCTGGCGAC
TCCGCGGCGGCGGGCGGCAAGCCAAGCGGACACTCCCTGTCCCCCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGACTCGCCCCCC
GGCTGCTCGGGCCAGGCCCTGAGCCTGGCGCCCACGCCCGCCGAGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCGCGCCGGCAGC
CCCCCGGGCCCCCCGGGCGCGGGCGGCCAGCTCGGCTTCCCAGGCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCTGACCGTGGGC
CACCGAGCCCGGCTGCACAACGTGATCCACCGCGCGCTGCACGCGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGAGCGCAGGACC
TGCGGCGGCTGCAGGGACGGCCACTGCAGCCCGCCCGCCGCCGGCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGCGGCCGCGGCC
TGCAACGTCATCGTGAACGGCACGCGCGGCGCCGCCGCCGAGGGCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCCGCCGCCGCCG
CCGCCCGCGCCCCCCAAGAAGCTGCTGTCGCCTGAGGAACCGGCGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTGTGCTTCCAAC
TGCCACCTGGACGGGGAGGCGGCCAAAAAGCTGATGGGCGAGGAGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCTTAATAACCCC
GCGGACGAGGACCATGCCTATGCTCTGCGGATGCTGCCCAAGACCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGAGAAGGCTGCC
ATGGCACCGTGCATCATCTCCTCGCCCATGCTCAGCGCCGGGCCTGAGGACCTGGAGCCGCCGCTCAAAAGGAGGTGCCTCCGAATTAGA
AATCAGAATAAGTAAAAGGAACGTTCACTCACAGGGTACGCTCATGGAGAGAGGGCGCAGAGCAAACCATGTCACGCCATCCAATGACAC
CAGCTGGTCAGCTCACCACCCCCTCTGGCTAAAACTCAAGCAAATAAAGCCGCTTCCTGTCATTAAGCATCTCAGAGGAAGCAGCCCTCC
CTCGATGGCCTCTAGCCCAGAGAAGCCCGCGCATCTTGGACCCACCAAGCAGGCCCAGCCTTCCTGCTGCCACCATCTCTGCTTCTCCCC
AGAGGAACTTAGGGATTTCACCCCTGGCTTTTAAAAAAAACGAAATACCGACAAGCCACAAGGACCAATGTAGGTATTCTCCCCGCCCCA
TCTTCAAGGCTCAGCGACTGAGGCTGGAAGATGATATGGATTGGAACACAAAAAATCTTTTTTTAATCTTTTTAAAAACTGCTGTGGTTT
TGCTGCTACACTAAGAATTGTGATTTGCATTGTACGGTTTTGGACCTATATTGTTCACGTTTTGATGGCGGAGAGGGGTGGTCCTGGAGG
CCCAATGCTTCAGAGTCATCTCTGTCCTGCCCGGGATGCACTTTTAAATGAAGAGTTAGAATATTTTATTGGCTAATATACTTTTCTTGT
TATTTTTACAAAGGCCACCTTTATCCTTTTTGATGCCATATTTTCAGTGTTACACTTTTATGGCTTTTAATTTTCGATTTGACAGATGTA
AGAAGCAGCATGAATAGTTTATACTGTGGTTTTTCAGAGACTGAATGCCAAGAGAACTCGGTAAATGTTTATTCTTCTCAGCTTTCTCTT
TAAATTCCCCTAAATAGCGCCCCATTTGGGAACAGAGCAAGAGTGTTGAACTGAAGACCAAAATGCCCTCAAGGTGTAAAATAATCCGAG
GGGGAATATTTGCTGGGCGTCAGGAAAGACTCAGATGAAATTTCAACCCTGATGGTTTTCGGTGATCCAGGAAGTCAGTGAGACAATCTC
TCTATATGCAGAGCCCTTTCATGATAATTAGAATGGTATGGACAAACCAATGAAAACAAGAGGGAAAGTGAGAAAGATCACCCATGATTC
TGTTTCACTGTTTGCTTTCTCCTGTCATGGTTAAGAGAAATGTGCAATTCGATCCTCAATCAGTGGGTGGAGGATAACAGGGTAGATTCA
CTTGTGTGCACTTGTACAGTTGTAGCTGCGAGTCCAGAAGTCCTCTAGAGCATGTGTACTGGCACTGAGTTGGTGAGACAGTTGTGGAGT
ATCCCATTCTGATGAGTACAGAAAAAAAAAGAAAAAGAAAAGAAGAGAAAAAATTAAGAAAAAAATCAAAAAAGGAAGAAAACTAAAAAA
AAAAAAAATCAAATCACCTTGTGATTCAGTGTATCTGTTTACTAACTCAAATAAAGCAATTGTTCCCTCTGGAGGGGTCCAGGTGCCCCC
GCCCCACAAGGCCGCGGAGCCTCAGCAGGAGGGGTGGCGAGTTGCGGGTGGGCAGGGCCAGGACGGTGTGGCGCCAGCCTTGAAGCACCA
CGGCCCAAGGATGCGGTGTACATACTGTATTTCTAGATTCTCCTTTGTACAGAGTCACTTCACAAGTCAAGCTACTGTTTTACAGGTGCT
CCTTATTTATTAGAGCTGTGAGAGCTTGGGGGACACACCTGGCGAGCAAGCTCGCTTTTTAAAAATGAAATTTGGGGGCAGGGGAAGGGG
AGGCGGGAGGGAGGGGAAGCTCGCAAGCCCGGGGAGAGATTTATAAAAGTAAACAAAAGAAAACCTTCCAGCAACAAATTAAAAAATAAT
AACAAATCAACCCCAGCACCAAACCCACCCAGGCAGGAAGAAGCCGCCCCTCCTCTGGGGCCATATTTTTCTGCTGGGTCACAACATTCT

>In-frame_CDKN2A_ENST00000530628_chr9_21994138_-_SOBP_ENST00000317357_chr6_107908284_+_4272nt
GGCAGGAGTGGCGCTGCTCACCTCTGGTGCCAAAGGGCGGCGCAGCGGCTGCCGAGCTCGGCCCTGGAGGCGGCGAGAACATGGTGCGCA
GGTTCTTGGTGACCCTCCGGATTCGGCGCGCGTGCGGCCCGCCGCGAGTGAGGGTTTTCGTGGTTCACATCCCGCGGCTCACGGGGGAGT
GGGCAGCGCCAGGGGCGCCCGCCGCTGTGGCCCTCGTGCTGATGCTACTGAGGAGCCAGCGTCTAGGGCAGCAGCCGCTTCCTAGAAGAC
CAGGCTAGAGATGAAGATGGACATGCTGAAAATTTTCCCCAGCAGCACTATGCTAAGGAAACTCCAAGGCTTGCCTTCAAGAATAACTGC
GAACTACTTGTATGTGACTGGTGTAAGCACATAAGACACACAAAAGAATACCTGGATTTTGGGGACGGGGAAAGAAGGCTTCAGTTCTGC
AGTGCAAAATGTCTCAATCAATACAAAATGGACATTTTCTACAAAGAGACCCAGGCCAATCTTCCAGCTGGGCTGTGCAGCACATTACAC
CCTCCCATGGAAAATAAAGCAGAAGGCACCGGGGTGCAGCTGCTCACTCCAGACTCTTGGAATATCCCGCTAACAGATGCTCGGAGGAAG
GCCCCCTCCCCGGTGGCTACAGCTGGCCAAAGCCAGGGCCCTGGCCCGTCGGCGTCCACCACCGTCTCTCCATCTGACACTGCCAACTGC
TCTGTCACTAAAATCCCCACGCCAGTGCCCAAGTCCATCCCCATCAGCGAGACTCCAAATATCCCTCCTGTCTCCGTCCAGCCACCTGCT
AGCATCGGGCCTCCCCTTGGCGTCCCGCCTCGGAGCCCTCCCATGGTGATGACCAACCGCGGCCCGGTGCCGCTGCCCATCTTCATGGAG
CAGCAGATCATGCAGCAGATCCGCCCGCCCTTCATCCGCGGGCCTCCGCACCATGCCTCCAACCCCAACAGCCCCCTGTCCAACCCCATG
CTTCCCGGCATCGGGCCCCCGCCCGGTGGCCCCAGAAACCTGGGCCCCACTTCCAGCCCCATGCACCGGCCCATGCTATCGCCCCACATC
CACCCCCCGAGCACCCCCACCATGCCCGGGAACCCCCCAGGCCTGCTGCCCCCGCCGCCTCCGGGCGCCCCGCTGCCGAGTCTTCCCTTC
CCGCCAGTGAGCATGATGCCAAATGGCCCGATGCCGGTGCCCCAGATGATGAATTTCGGGCTGCCGTCGCTTGCCCCGCTGGTGCCGCCC
CCGACCCTGCTCGTGCCGTACCCCGTGATCGTGCCCCTACCGGTGCCCATCCCCATCCCCATCCCTATCCCTCACGTCAGCGACTCCAAG
CCCCCCAACGGGTTCTCCAGCAACGGGGAGAACTTCATTCCGAACGCCCCTGGCGACTCCGCGGCGGCGGGCGGCAAGCCAAGCGGACAC
TCCCTGTCCCCCCGGGACTCCAAGCAGGGCTCGTCCAAGTCCGCGGACTCGCCCCCCGGCTGCTCGGGCCAGGCCCTGAGCCTGGCGCCC
ACGCCCGCCGAGCATGGCCGGAGCGAGGTGGTGGACCTGACGCGGCGCGCCGGCAGCCCCCCGGGCCCCCCGGGCGCGGGCGGCCAGCTC
GGCTTCCCAGGCGTGCTGCAGGGCCCGCAGGACGGCGTCATCGACCTGACCGTGGGCCACCGAGCCCGGCTGCACAACGTGATCCACCGC
GCGCTGCACGCGCACGTCAAGGCGGAGCGCGAGCCGAGCGCCGCGGAGCGCAGGACCTGCGGCGGCTGCAGGGACGGCCACTGCAGCCCG
CCCGCCGCCGGCGACCCAGGCCCGGGCGCCCCGGCGGGCCCCGAGGCGGCCGCGGCCTGCAACGTCATCGTGAACGGCACGCGCGGCGCC
GCCGCCGAGGGCGCTAAGAGCGCGGAGCCGCCTCCCGAGCAGCCGCCGCCGCCGCCGCCGCCCGCGCCCCCCAAGAAGCTGCTGTCGCCT
GAGGAACCGGCGGTGAGCGAGCTAGAGTCGGTCAAGGAGAATAACTGTGCTTCCAACTGCCACCTGGACGGGGAGGCGGCCAAAAAGCTG
ATGGGCGAGGAGGCCCTGGCGGGGGGCGACAAGTCAGACCCGAACCTTAATAACCCCGCGGACGAGGACCATGCCTATGCTCTGCGGATG
CTGCCCAAGACCGGCTGCGTGATCCAGCCTGTGCCAAAACCCGCGGAGAAGGCTGCCATGGCACCGTGCATCATCTCCTCGCCCATGCTC
AGCGCCGGGCCTGAGGACCTGGAGCCGCCGCTCAAAAGGAGGTGCCTCCGAATTAGAAATCAGAATAAGTAAAAGGAACGTTCACTCACA
GGGTACGCTCATGGAGAGAGGGCGCAGAGCAAACCATGTCACGCCATCCAATGACACCAGCTGGTCAGCTCACCACCCCCTCTGGCTAAA
ACTCAAGCAAATAAAGCCGCTTCCTGTCATTAAGCATCTCAGAGGAAGCAGCCCTCCCTCGATGGCCTCTAGCCCAGAGAAGCCCGCGCA
TCTTGGACCCACCAAGCAGGCCCAGCCTTCCTGCTGCCACCATCTCTGCTTCTCCCCAGAGGAACTTAGGGATTTCACCCCTGGCTTTTA
AAAAAAACGAAATACCGACAAGCCACAAGGACCAATGTAGGTATTCTCCCCGCCCCATCTTCAAGGCTCAGCGACTGAGGCTGGAAGATG
ATATGGATTGGAACACAAAAAATCTTTTTTTAATCTTTTTAAAAACTGCTGTGGTTTTGCTGCTACACTAAGAATTGTGATTTGCATTGT
ACGGTTTTGGACCTATATTGTTCACGTTTTGATGGCGGAGAGGGGTGGTCCTGGAGGCCCAATGCTTCAGAGTCATCTCTGTCCTGCCCG
GGATGCACTTTTAAATGAAGAGTTAGAATATTTTATTGGCTAATATACTTTTCTTGTTATTTTTACAAAGGCCACCTTTATCCTTTTTGA
TGCCATATTTTCAGTGTTACACTTTTATGGCTTTTAATTTTCGATTTGACAGATGTAAGAAGCAGCATGAATAGTTTATACTGTGGTTTT
TCAGAGACTGAATGCCAAGAGAACTCGGTAAATGTTTATTCTTCTCAGCTTTCTCTTTAAATTCCCCTAAATAGCGCCCCATTTGGGAAC
AGAGCAAGAGTGTTGAACTGAAGACCAAAATGCCCTCAAGGTGTAAAATAATCCGAGGGGGAATATTTGCTGGGCGTCAGGAAAGACTCA
GATGAAATTTCAACCCTGATGGTTTTCGGTGATCCAGGAAGTCAGTGAGACAATCTCTCTATATGCAGAGCCCTTTCATGATAATTAGAA
TGGTATGGACAAACCAATGAAAACAAGAGGGAAAGTGAGAAAGATCACCCATGATTCTGTTTCACTGTTTGCTTTCTCCTGTCATGGTTA
AGAGAAATGTGCAATTCGATCCTCAATCAGTGGGTGGAGGATAACAGGGTAGATTCACTTGTGTGCACTTGTACAGTTGTAGCTGCGAGT
CCAGAAGTCCTCTAGAGCATGTGTACTGGCACTGAGTTGGTGAGACAGTTGTGGAGTATCCCATTCTGATGAGTACAGAAAAAAAAAGAA
AAAGAAAAGAAGAGAAAAAATTAAGAAAAAAATCAAAAAAGGAAGAAAACTAAAAAAAAAAAAAATCAAATCACCTTGTGATTCAGTGTA
TCTGTTTACTAACTCAAATAAAGCAATTGTTCCCTCTGGAGGGGTCCAGGTGCCCCCGCCCCACAAGGCCGCGGAGCCTCAGCAGGAGGG
GTGGCGAGTTGCGGGTGGGCAGGGCCAGGACGGTGTGGCGCCAGCCTTGAAGCACCACGGCCCAAGGATGCGGTGTACATACTGTATTTC
TAGATTCTCCTTTGTACAGAGTCACTTCACAAGTCAAGCTACTGTTTTACAGGTGCTCCTTATTTATTAGAGCTGTGAGAGCTTGGGGGA
CACACCTGGCGAGCAAGCTCGCTTTTTAAAAATGAAATTTGGGGGCAGGGGAAGGGGAGGCGGGAGGGAGGGGAAGCTCGCAAGCCCGGG
GAGAGATTTATAAAAGTAAACAAAAGAAAACCTTCCAGCAACAAATTAAAAAATAATAACAAATCAACCCCAGCACCAAACCCACCCAGG
CAGGAAGAAGCCGCCCCTCCTCTGGGGCCATATTTTTCTGCTGGGTCACAACATTCTCCTCTCCCTGACTGGTGTCAGATTCATCAAACA


Top

FusionGenePPI for CDKN2A_SOBP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDKN2APPP1R9B, CDK4, AURKA, CDK6, CCND2, SERTAD1, MDM2, RPL11, TP53, UBE2A, FKBP2, CCND1, E4F1, CCNG1, MDM4, ING4, DAXX, TOP1, PSME3, PSMC3, LAMTOR3, SMARCA4, ING1, KAT5, YY1, NPM1, SAP25, TRIP12, HUWE1, PCNA, MCM6, UCHL1, VHL, SP1, TTF1, HIST3H2BB, HDAC1, ARFIP2, GGA1, WRN, TP63, NCL, PPP1CB, PPP1CC, COMMD1, TRADD, UBE2I, CUL2, COPS5, SENP3, CDK5RAP3, CTBP2, RNF2, PIAS2, MYC, BRCA1, IKBKB, GGA3, CDKN2AIP, NMI, ATR, MYCN, HIF1A, E2F1, EGR1, SLC4A1, ZNF420, SIVA1, GMNN, ORC4, CDC6, CDC5L, CDC45, CDC7, MCM2, MCM10, MCM5, MAPK8, MAPK10, DEAF1, TDRD7, CRELD2, HNRNPU, FN1, PRKCA, DYRK1B, HIPK4, CDK11A, CLK2, UBE4B, USP26, SNRPA, TUBA1C, TUBB4B, TUBA1A, TUBB, HSPA9, SNRPB, RUVBL2, RIN2, PDCD6, MMRN1, MYL12A, MTR, HNRNPC, HSPA4, HSPA8, HSP90AB1, HSP90AA1, GAPDH, EPHA3, EEF2, ACLY, ACTN4, ACTG1, ACTB, HNRNPA2B1, BRK1, ACTA1, ACTBL2, CSTF2, LSM8, NCKAP1, RPP38, GNL3, DGCR8, BCL2L1, C1QBP, BECN1, RELA, MOV10, NXF1, PA2G4, ZBTB17, ANGPTL4, CASC3, NAT2, WHSC1L1, MYO1C, IQGAP1, MIS12, BAG6, CFAP97, TRIM28, PML, KAT2B, GLTSCR2, RRM2, IGF1R, PTEN, UBC, ANKRA2, ASPRV1, AZIN1, ANAPC15, ZGRF1, CCNDBP1, CENPA, EFHC2, EXOC2, HLA-DOB, MAF1, MGC34796, PTP4A3, RBM26, SIX2, UBL7, VAMP1, ZNF687, ZUFSPSOBPCELF3, CTBP1, SUMO2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000361570-131_64105220CDK5RAP3 and MDM2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000530628-131_6464122CDK5RAP3 and MDM2
HgeneCDKN2Achr9:21994138chr6:107908284ENST00000579755-131_6464134CDK5RAP3 and MDM2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDKN2A_SOBP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDKN2A_SOBP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCDKN2AC1835044MELANOMA, CUTANEOUS MALIGNANT, 211CTD_human;UNIPROT
HgeneCDKN2AC0024121Lung Neoplasms4CTD_human
HgeneCDKN2AC0011570Mental Depression3PSYGENET
HgeneCDKN2AC0011581Depressive disorder3PSYGENET
HgeneCDKN2AC0023903Liver neoplasms3CTD_human
HgeneCDKN2AC0005695Bladder Neoplasm2CTD_human
HgeneCDKN2AC0006118Brain Neoplasms2CTD_human
HgeneCDKN2AC0007131Non-Small Cell Lung Carcinoma2CTD_human
HgeneCDKN2AC0017638Glioma2CTD_human
HgeneCDKN2AC0030297Pancreatic Neoplasm2CTD_human
HgeneCDKN2AC0040715Chromosomal translocation2CTD_human
HgeneCDKN2AC0041696Unipolar Depression2PSYGENET
HgeneCDKN2AC0345967Malignant mesothelioma2CTD_human
HgeneCDKN2AC1168401Squamous cell carcinoma of the head and neck2CTD_human
HgeneCDKN2AC1269683Major Depressive Disorder2PSYGENET
HgeneCDKN2AC0001418Adenocarcinoma1CTD_human
HgeneCDKN2AC0001624Adrenal Gland Neoplasms1CTD_human
HgeneCDKN2AC0007137Squamous cell carcinoma1CTD_human;HPO
HgeneCDKN2AC0008628Chromosome Deletion1CTD_human
HgeneCDKN2AC0014859Esophageal Neoplasms1CTD_human
HgeneCDKN2AC0017601Glaucoma1CTD_human
HgeneCDKN2AC0022783Vulvar Lichen Sclerosus1CTD_human
HgeneCDKN2AC0024299Lymphoma1CTD_human
HgeneCDKN2AC0025202melanoma1CTD_human;HPO
HgeneCDKN2AC0025500Mesothelioma1CTD_human
HgeneCDKN2AC0026640Mouth Neoplasms1CTD_human
HgeneCDKN2AC0026764Multiple Myeloma1CTD_human
HgeneCDKN2AC0027626Neoplasm Invasiveness1CTD_human
HgeneCDKN2AC0027819Neuroblastoma1CTD_human
HgeneCDKN2AC0031117Peripheral Neuropathy1CTD_human
HgeneCDKN2AC0032927Precancerous Conditions1CTD_human
HgeneCDKN2AC0036920Sezary Syndrome1CTD_human
HgeneCDKN2AC0038356Stomach Neoplasms1CTD_human
HgeneCDKN2AC0040100Thymoma1CTD_human
HgeneCDKN2AC0041107Trisomy1CTD_human
HgeneCDKN2AC0042065Genitourinary Neoplasms1CTD_human
HgeneCDKN2AC0079744Diffuse Large B-Cell Lymphoma1CTD_human
HgeneCDKN2AC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneCDKN2AC0151779Cutaneous Melanoma1CTD_human
HgeneCDKN2AC0206686Adrenocortical carcinoma1CTD_human
HgeneCDKN2AC0206727Nerve Sheath Tumors1CTD_human
HgeneCDKN2AC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneCDKN2AC0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneCDKN2AC0596263Carcinogenesis1CTD_human
HgeneCDKN2AC0677866Brain Stem Neoplasms1CTD_human
HgeneCDKN2AC0887833Carcinoma, Pancreatic Ductal1CTD_human
HgeneCDKN2AC1449861Micronuclei, Chromosome-Defective1CTD_human
HgeneCDKN2AC1458155Mammary Neoplasms1CTD_human
HgeneCDKN2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human
HgeneCDKN2AC2239176Liver carcinoma1CTD_human
HgeneCDKN2AC2931822Nasopharyngeal carcinoma1CTD_human
TgeneSOBPC0033975Psychotic Disorders1PSYGENET
TgeneSOBPC0349204Nonorganic psychosis1PSYGENET