FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6596

FusionGeneSummary for CDKAL1_ASH1L

check button Fusion gene summary
Fusion gene informationFusion gene name: CDKAL1_ASH1L
Fusion gene ID: 6596
HgeneTgene
Gene symbol

CDKAL1

ASH1L

Gene ID

54901

55870

Gene nameCDK5 regulatory subunit associated protein 1 like 1ASH1 like histone lysine methyltransferase
Synonyms-ASH1|ASH1L1|KMT2H|MRD52
Cytomap

6p22.3

1q22

Type of geneprotein-codingprotein-coding
Descriptionthreonylcarbamoyladenosine tRNA methylthiotransferasetRNA-t(6)A37 methylthiotransferasehistone-lysine N-methyltransferase ASH1LASH1-like proteinabsent small and homeotic disks protein 1 homologash1 (absent, small, or homeotic)-likelysine N-methyltransferase 2Hprobable histone-lysine N-methyltransferase ASH1L
Modification date2018052320180519
UniProtAcc

Q5VV42

Q9NR48

Ensembl transtripts involved in fusion geneENST00000274695, ENST00000378624, 
ENST00000378610, ENST00000476517, 
ENST00000368346, ENST00000392403, 
ENST00000548830, 
Fusion gene scores* DoF score23 X 12 X 11=30369 X 8 X 5=360
# samples 229
** MAII scorelog2(22/3036*10)=-3.78659636189081
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/360*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDKAL1 [Title/Abstract] AND ASH1L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneASH1L

GO:0097676

histone H3-K36 dimethylation

26002201


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-33-4587-01ACDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000274695ENST00000368346CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
In-frameENST00000274695ENST00000392403CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
5CDS-intronENST00000274695ENST00000548830CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
In-frameENST00000378624ENST00000368346CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
In-frameENST00000378624ENST00000392403CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
5CDS-intronENST00000378624ENST00000548830CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
In-frameENST00000378610ENST00000368346CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
In-frameENST00000378610ENST00000392403CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
5CDS-intronENST00000378610ENST00000548830CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
intron-3CDSENST00000476517ENST00000368346CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
intron-3CDSENST00000476517ENST00000392403CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-
intron-intronENST00000476517ENST00000548830CDKAL1chr6

20846409

+ASH1Lchr1

155349907

-

Top

FusionProtFeatures for CDKAL1_ASH1L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDKAL1

Q5VV42

ASH1L

Q9NR48

Catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), leading to the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position37 in tRNAs that read codons beginning with adenine.{ECO:0000269|PubMed:20584901}. Histone methyltransferase specifically methylating 'Lys-36' of histone H3 (H3K36me). {ECO:0000269|PubMed:21239497}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000274695+91664_172247580DomainMTTase N-terminal
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378610+71464_172247580DomainMTTase N-terminal
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378624+81464_172177489DomainMTTase N-terminal
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0281380_1424-2142970Compositional biasNote=Pro-rich
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0281580_1791-2142970Compositional biasNote=Ser-rich
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0281347_1359-2142970DNA bindingNote=A.T hook 2
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0281847_1859-2142970DNA bindingNote=A.T hook 3
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-028887_899-2142970DNA bindingNote=A.T hook 1
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282091_2142-2142970DomainAWS
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282145_2261-2142970DomainSET
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282269_2285-2142970DomainPost-SET
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282463_2533-2142970DomainBromo
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282661_2798-2142970DomainBAH
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282091_214220342965DomainAWS
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282145_226120342965DomainSET
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282269_228520342965DomainPost-SET
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282463_253320342965DomainBromo
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282661_279820342965DomainBAH
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282069_2288-2142970RegionNote=Catalytic domain
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282069_228820342965RegionNote=Catalytic domain
TgeneASH1Lchr6:20846409chr1:155349907ENST00000368346-0282585_2631-2142970Zinc fingerNote=PHD-type
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6282585_263120342965Zinc fingerNote=PHD-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000274695+916431_493247580DomainTRAM
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378610+714431_493247580DomainTRAM
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378624+814431_493177489DomainTRAM
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000274695+916556_578247580TransmembraneHelical
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378610+714556_578247580TransmembraneHelical
HgeneCDKAL1chr6:20846409chr1:155349907ENST00000378624+814556_578177489TransmembraneHelical
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6281380_142420342965Compositional biasNote=Pro-rich
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6281580_179120342965Compositional biasNote=Ser-rich
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6281347_135920342965DNA bindingNote=A.T hook 2
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-6281847_185920342965DNA bindingNote=A.T hook 3
TgeneASH1Lchr6:20846409chr1:155349907ENST00000392403-628887_89920342965DNA bindingNote=A.T hook 1


Top

FusionGeneSequence for CDKAL1_ASH1L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_247aa
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKTLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGETMAGQLAAT
GTKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG

>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_1178aa
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKTLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGETMAGQLAAT
GTKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG
QKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASTPIDELVDRAKQSFQGKTLRQKRIDFQLPTDILWQWKH
NQLYKKPDVPLTKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRA
EEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQTHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRI
GLTALKDMPAGTELTTDTNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNGLTSSKNSQPMATHKKSGRSKEKRKSKHKLKKRRGHLSEE
PSENINTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLTTRWNGICRDDGNIKSDVFMTQFSALQTA
RSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISTKDSSRQALAAPLLNLPPKKKNADTTEKISDPLDLITIEKQILTGYTKTVEAFD
ADMLKVFRNAEKYTGRKSPVGRDVCRLRKATYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDVIRCICGLYKDEGLMIQC
DKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHTAQPGCVYFICLLRDDLLLRQGDCVTLMRDSRRTPDGHPVRQSTRLLS
HINRDKLDIFRIEKLWKNEKEERFAFGHHTFRPHETHHSPSRRFTHNELFRVPLTEIIPLEAVVGTCCVLDLTTTCKGRPKGVKEQDVYI
CDTRLDKSAHLFYKIHRNRTPVCTKPTAFDHFPKKLTPKKDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQE
QAANEIPSLEEPEREGATANVSEGEKKTEESSQEPQSTCTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLFI

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_177aa
MLSRRYEGEIPKNICKRKKTVHQVTENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQI

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_1108aa
MLSRRYEGEIPKNICKRKKTVHQVTENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQI
DRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASTPIDELVDRAKQSFQGKT
LRQKRIDFQLPTDILWQWKHNQLYKKPDVPLTKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQ
CCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQTHNHSDHYCLNLDSGMVIDSYRMGNEARFIN
HSCDPNCEMQKWSVNGVYRIGLTALKDMPAGTELTTDTNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNGLTSSKNSQPMATHKKSGRS
KEKRKSKHKLKKRRGHLSEEPSENINTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLTTRWNGICR
DDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISTKDSSRQALAAPLLNLPPKKKNADTTEKISDPLD
LITIEKQILTGYTKTVEAFDADMLKVFRNAEKYTGRKSPVGRDVCRLRKATYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKD
DDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHTAQPGCVYFICLLRDDLLLRQGDCVTLM
RDSRRTPDGHPVRQSTRLLSHINRDKLDIFRIEKLWKNEKEERFAFGHHTFRPHETHHSPSRRFTHNELFRVPLTEIIPLEAVVGTCCVL
DLTTTCKGRPKGVKEQDVYICDTRLDKSAHLFYKIHRNRTPVCTKPTAFDHFPKKLTPKKDFSPHYVPDNYKRNGGRSSWKSERSKPPLK
DLGQEDDALPLIEEVLASQEQAANEIPSLEEPEREGATANVSEGEKKTEESSQEPQSTCTPEERRHNQRERLNQILLNLLEKIPGKNAID

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_247aa
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKTLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGETMAGQLAAT
GTKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_1178aa
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKTLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGETMAGQLAAT
GTKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG
QKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASTPIDELVDRAKQSFQGKTLRQKRIDFQLPTDILWQWKH
NQLYKKPDVPLTKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRA
EEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQTHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRI
GLTALKDMPAGTELTTDTNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNGLTSSKNSQPMATHKKSGRSKEKRKSKHKLKKRRGHLSEE
PSENINTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLTTRWNGICRDDGNIKSDVFMTQFSALQTA
RSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISTKDSSRQALAAPLLNLPPKKKNADTTEKISDPLDLITIEKQILTGYTKTVEAFD
ADMLKVFRNAEKYTGRKSPVGRDVCRLRKATYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDVIRCICGLYKDEGLMIQC
DKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHTAQPGCVYFICLLRDDLLLRQGDCVTLMRDSRRTPDGHPVRQSTRLLS
HINRDKLDIFRIEKLWKNEKEERFAFGHHTFRPHETHHSPSRRFTHNELFRVPLTEIIPLEAVVGTCCVLDLTTTCKGRPKGVKEQDVYI
CDTRLDKSAHLFYKIHRNRTPVCTKPTAFDHFPKKLTPKKDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQE
QAANEIPSLEEPEREGATANVSEGEKKTEESSQEPQSTCTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLFI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_742nt
ATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTA
AGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATT
CCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTAT
GGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGA
AACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAG
GGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGT
CAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATC
AATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGAT

>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_3534nt
ATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTA
AGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATT
CCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTAT
GGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGA
AACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAG
GGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGT
CAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATC
AATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGAT
AGAGCCAAACAATCTTTTCAAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACAC
AATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAA
GCTACCACCTGTAACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGT
TCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCT
GAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAG
GAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTAC
CGCATGGGAAATGAGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATT
GGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTT
TGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCC
ATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAA
CCCAGTGAAAATATCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAG
CATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCA
TTATATACCCGTTGGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCT
CGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATT
TGTGATGGTATCATCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGAT
TATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGAT
GCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCC
TATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTC
TCTGAAAAGGAGAATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGT
GACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCT
GTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTG
CTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCT
CACATTAACCGAGATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTAT
TTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTG
GAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATC
TGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGAT
CACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGG
AAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAG
CAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAA
AGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTT
GAAAAAATCCCTGGAAAAAATGCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTGTTTATC

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_532nt
ATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGAAAATGCATCCGAT
GCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAAC
AAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATA
GATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGG
GGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTAC

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_3324nt
ATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGAAAATGCATCCGAT
GCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAAC
AAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATA
GATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGG
GGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTAC
TGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGATAGAGCCAAACAATCTTTTCAAGGAAAGTAT
CTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACACAATCAGCTATACAAAAAGCCAGATGTCCCA
CTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTAACTGTAAGAAGCCAGAT
GATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGTTCCCCCAACACTTGCCCATGTGGCGAGCAA
TGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTTGGGGAATCAGAACCAAA
GAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAGGAGTTCAGGAACAGGATGATTGAGCAGTAT
CATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATGAGGCCCGATTCATCAAC
CATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATTGGACTCTATGCTCTTAAAGACATGCCAGCT
GGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCTTTGAGAAATGTCGAGGA
ATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCCATGGCCACACACAAAAAATCTGGACGGTCA
AAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATATCAACACCCCAACTAGA
TTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAGCATCATGTATTCTTGGTCCGAAACTGGGAG
AAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCATTATATACCCGTTGGAATGGGATCTGCCGA
GATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCTCGATCTGTTCGAACAAGACGGTTGGCAGCT
GCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCATCTCTTATAAAGATTCT
TCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGATTATTATGAGAAGATCTCTGATCCCCTAGAT
CTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCAAAGTCTTTCGGAATGCT
GAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCCTATTACAATGCCCGGCATGAGGCATCAGCC
CAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGAATGGGCATGAGAAGGAC
GACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGTGACAAGTGCATGGTATGGCAGCACTGTGAT
TGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGGTTCCCATGATCCCTCGG
CCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTGCTTCGTCAGGGTGACTGTGTGTATCTGATG
AGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCTCACATTAACCGAGATAAACTTGACATCTTT
CGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTATTTCCGTCCCCACGAAACACACCACTCTCCA
TCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGGGGACCTGCTGTGTGTTG
GACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATCTGTGATTATCGGCTTGACAAGTCAGCACAC
CTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGAAGCTCACTCCCAAAAAA
GATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGGAAGTCTGAGCGCTCAAAGCCACCCCTAAAA
GACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATGAGATACCCAGCCTGGAG
GAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAAAGTAGTCAAGAACCCCAGTCAACCTGTACC
CCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTGGAAAAAATGCCATTGAT

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_742nt
ATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTA
AGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATT
CCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTAT
GGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGA
AACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAG
GGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGT
CAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATC
AATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGAT

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_3534nt
ATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTA
AGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATT
CCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTAT
GGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGA
AACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAG
GGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGT
CAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATC
AATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGAT
AGAGCCAAACAATCTTTTCAAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACAC
AATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAA
GCTACCACCTGTAACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGT
TCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCT
GAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAG
GAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTAC
CGCATGGGAAATGAGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATT
GGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTT
TGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCC
ATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAA
CCCAGTGAAAATATCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAG
CATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCA
TTATATACCCGTTGGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCT
CGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATT
TGTGATGGTATCATCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGAT
TATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGAT
GCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCC
TATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTC
TCTGAAAAGGAGAATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGT
GACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCT
GTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTG
CTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCT
CACATTAACCGAGATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTAT
TTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTG
GAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATC
TGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGAT
CACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGG
AAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAG
CAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAA
AGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTT
GAAAAAATCCCTGGAAAAAATGCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTGTTTATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_4015nt
AAATAAACGTGGCGGGACGTATGTGTCATGGCGCTCTCCATCTAAAGTCTGTGCAGCTTCCGGAGAGTGGCGGGTTGATTTTCTCACTTT
GGACTGGTTTTTACTTCCCGACTTCTGGACTCATCTTTCAAGAGGACTTTAGACTAATTGCAGATAATTAAGAGAATATGCCTTCTGCAT
CCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTAAGAAAGGATGTTG
TCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATTCCAGGCATACAGA
AAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTATGGCTATAAAATTA
CAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAA
AAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCA
TTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATA
ATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTC
TCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGATAGAGCCAAACAAT
CTTTTCAAGTGTTTTTTGTTTCAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAAC
ACAATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACG
AAGCTACCACCTGTAACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGT
GTTCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAG
CTGAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAAC
AGGAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTT
ACCGCATGGGAAATGAGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGA
TTGGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAAC
TTTGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGC
CCATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGG
AACCCAGTGAAAATATCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAA
AGCATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCAT
CATTATATACCCGTTGGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAG
CTCGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAA
TTTGTGATGGTATCATCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTG
ATTATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTG
ATGCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGG
CCTATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAG
TCTCTGAAAAGGAGAATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGT
GTGACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGC
CTGTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGC
TGCTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTAT
CTCACATTAACCGAGATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATT
ATTTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCT
TGGAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACA
TCTGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTG
ATCACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCT
GGAAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAG
AGCAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGG
AAAGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCC
TTGAAAAAATCCCTGGAAAAAATGGTGCAGTCTCCAAAGAGATTACGAATGCCTTGGAAACCTGGGGTGCCTTGGGTCAGGACATCAACT
TGGACATTCCTAGTTTTCAAATGAGTGATGATATTGACGATATAAAATGGGAAAAAACTTCAGACAAGAAAAAGATTGCACAATTCAGAA
AAGAGAAAGAGACTTTCAAGGAAAAAGATACATATAAGCTATTTAAAAATGGAACTCTGAAAATTAAGCATCTGAAGACCGATGATCAGG
ATATCTACAAGGTATCAATATATGATACAAAAGGAAAAAATGTGTTGGAAAAAATATTTGATTTGAAGATTCAAGGTAAGTGTTCATTCC

>In-frame_CDKAL1_ENST00000274695_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_5306nt
AAATAAACGTGGCGGGACGTATGTGTCATGGCGCTCTCCATCTAAAGTCTGTGCAGCTTCCGGAGAGTGGCGGGTTGATTTTCTCACTTT
GGACTGGTTTTTACTTCCCGACTTCTGGACTCATCTTTCAAGAGGACTTTAGACTAATTGCAGATAATTAAGAGAATATGCCTTCTGCAT
CCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTAAGAAAGGATGTTG
TCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGCACTATTCCAGGCATACAGA
AAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCTAGCTGCTTATGGCTATAAAATTA
CAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAA
AAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCA
TTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATA
ATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTC
TCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGATAGAGCCAAACAAT
CTTTTCAAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACACAATCAGCTATACA
AAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTA
ACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGTTCCCCCAACACTT
GCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTT
GGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAGGAGTTCAGGAACA
GGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATG
AGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATTGGACTCTATGCTC
TTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCT
TTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCCATGGCCACACACA
AAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATA
TCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAGCATCATGTATTCT
TGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCATTATATACCCGTT
GGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCTCGATCTGTTCGAA
CAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCA
TCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGATTATTATGAGAAGA
TCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCA
AAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCCTATTACAATGCCC
GGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGA
ATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGTGACAAGTGCATGG
TATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGG
TTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTGCTTCGTCAGGGTG
ACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCTCACATTAACCGAG
ATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTATTTCCGTCCCCACG
AAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGG
GGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATCTGTGATTATCGGC
TTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGA
AGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGGAAGTCTGAGCGCT
CAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATG
AGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAAAGTAGTCAAGAAC
CCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTG
GAAAAAATGCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTGTTTATCCCAGAAAACAGCT
TTCGAAAGTGACCCTCAAAGAATGAGAACCTCAAGCATCTGGGATCCAGTGGAGCTAATCAGTCCTGCCTCCTGCTCTCTGGGTATAGAC
AGGGGTGGGAAGGGTCCATCTGGGCAAGGGGAATGGGGCCATGTTGTTGACATTAGGTACTTAATAAGCCTTGGAGCTAGTGGAGAGGGA
GAGGAAAGGGTTCTGTCCAAGACAGTTCAGGTTAATTAATTTTCTTCTCCATTGCTTCACCTTAAGGGTTAATAATGTAGAGAGGAGGGA
GGACCACATTGATGACCAGAACCTACTGGTACTTTATAGCATTTGCCCCACCCCACAGCTTAGGTTTTTCTGTCATCCTCAGATCCCACA
GGCATTGCGAAGAAGCTGCTTCCTATACCCAGGTATAACTCAAAATCCAAAGGGATAGGGCCAGGATCCCTATTCCTACCCCATCTATTC
TCTGTTGGCTCCAAGAGCTACCCCAGAGACCTTAAACAGAAACAGTAGCTGAGGCTTCTTCCTAGATACCTGACTAGGGAAGTTTGTCTC
TCCTTTCTTGCCCAACCAGGTCAAAGTAAAATGTGAGTTGACAGCTCAAAGCACTTGTAACTGCTGCCCCCTCCCTACCTCTACTCCCCA
AAATGGAATCATGGGATAGGGAAGGCCCCCATGGGGTCAGAAGGGCACGGTAGTTCTTGCAATTATTTTTGTTTTACCCTTCATAACCTG
TCAAACATATTTTTTTCTAATGAGAAAGCCAGGCCCCCGCCAGCACACATGCTGTTTTTAATGCGCTGTAGTTCTTGTGTGTCTGCTGTG
CTGTGCAAATGGAGATTCAGTTCAAAATAAAATCATTTAAAAACCTACATAAAAAGAACTCTAAACCCACCCCTGCAACAAAAGTCACTA
CATAAACTGTTCAGCAGTATTCACCTATCAGAGTATTTGTTGTGAGTATAGATTATCAATTGAAAACACTACTCTTGTTTTCTTAATTGT
ACAGTTTTCAATGTCCCTTTCTTAAAGAGACAGTATATTTCTCTTCACCCCTAGCCCATCTTCCCTCACCCTCCTGAATGACATCAGGAG
GTATATCCAGGGTGTCTCCTTCCTTCCTACTCTCTTGACCAGAAGTTAACAGACTATACTGTCTCTTTAAAAATAAAATTTAAAAAGCTT
TGTTGTCTTTTCAGACATACATATGCATATATGTTTTAGATGTTCTTATAAGAGAAAAGATGGTTTTTAAATGTGCCAAGTTGTGTGTGT
GTGTGTATATATATGTGTGTATGTGTGTGTATATATATATGTGTGTGTGTATATATATACACACACACACACACACCTGCTGTGTGATTG
GTAAGCAATACAATAGTAAACATGTCCCCATTACTTTTTTCTAATATTGGACCAATGCTGTCCTAATTGTACATTTCCCCTTATGGTGAC
GATGCTCTGACTCGTTTAGGTAGACACATTGACCACCTTCCATTCCATTAAATATTTTTTCCTTTTTCCCCTTTCTGTGTCATTCTTGAG

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_5208nt
AAATAAACGTGGCGGGACGTATGTGTCATGGCGCTCTCCATCTAAAGTCTGTGCAGCTTCCGGAGAGTGGCGGGTTGATTTTCTCACTTT
GGACTGGTTTTTACTTCCCGACTTCTGGACTCATCTTTCAAGAGGACTTTAGACTAATTGCAGATAATTAAGAGAATATGCCTTCTGCAT
CCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTAAGAAAGGATGTTG
TCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGAAAATGCATCCGATGCAGAT
TTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAA
ATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATAGATCGT
GTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCA
CGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTACTGCAAA
ACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGATAGAGCCAAACAATCTTTTCAAGTGTTTTTTGTTTCA
GGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACACAATCAGCTATACAAAAAGCCA
GATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTAACTGTAAG
AAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGTTCCCCCAACACTTGCCCATGT
GGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTTGGGGAATC
AGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAGGAGTTCAGGAACAGGATGATT
GAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATGAGGCCCGA
TTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATTGGACTCTATGCTCTTAAAGAC
ATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCTTTGAGAAA
TGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCCATGGCCACACACAAAAAATCT
GGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATATCAACACC
CCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAGCATCATGTATTCTTGGTCCGA
AACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCATTATATACCCGTTGGAATGGG
ATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCTCGATCTGTTCGAACAAGACGG
TTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCATCTCTTAT
AAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGATTATTATGAGAAGATCTCTGAT
CCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCAAAGTCTTT
CGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCCTATTACAATGCCCGGCATGAG
GCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGAATGGGCAT
GAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGTGACAAGTGCATGGTATGGCAG
CACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGGTTCCCATG
ATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTGCTTCGTCAGGGTGACTGTGTG
TATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCTCACATTAACCGAGATAAACTT
GACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTATTTCCGTCCCCACGAAACACAC
CACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGGGGACCTGC
TGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATCTGTGATTATCGGCTTGACAAG
TCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGAAGCTCACT
CCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGGAAGTCTGAGCGCTCAAAGCCA
CCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATGAGATACCC
AGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAAAGTAGTCAAGAACCCCAGTCA
ACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTGGAAAAAAT
GCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTGTTTATCCCAGAAAACAGCTTTCGAAAG
TGACCCTCAAAGAATGAGAACCTCAAGCATCTGGGATCCAGTGGAGCTAATCAGTCCTGCCTCCTGCTCTCTGGGTATAGACAGGGGTGG
GAAGGGTCCATCTGGGCAAGGGGAATGGGGCCATGTTGTTGACATTAGGTACTTAATAAGCCTTGGAGCTAGTGGAGAGGGAGAGGAAAG
GGTTCTGTCCAAGACAGTTCAGGTTAATTAATTTTCTTCTCCATTGCTTCACCTTAAGGGTTAATAATGTAGAGAGGAGGGAGGACCACA
TTGATGACCAGAACCTACTGGTACTTTATAGCATTTGCCCCACCCCACAGCTTAGGTTTTTCTGTCATCCTCAGATCCCACAGGCATTGC
GAAGAAGCTGCTTCCTATACCCAGGTATAACTCAAAATCCAAAGGGATAGGGCCAGGATCCCTATTCCTACCCCATCTATTCTCTGTTGG
CTCCAAGAGCTACCCCAGAGACCTTAAACAGAAACAGTAGCTGAGGCTTCTTCCTAGATACCTGACTAGGGAAGTTTGTCTCTCCTTTCT
TGCCCAACCAGGTCAAAGTAAAATGTGAGTTGACAGCTCAAAGCACTTGTAACTGCTGCCCCCTCCCTACCTCTACTCCCCAAAATGGAA
TCATGGGATAGGGAAGGCCCCCATGGGGTCAGAAGGGCACGGTAGTTCTTGCAATTATTTTTGTTTTACCCTTCATAACCTGTCAAACAT
ATTTTTTTCTAATGAGAAAGCCAGGCCCCCGCCAGCACACATGCTGTTTTTAATGCGCTGTAGTTCTTGTGTGTCTGCTGTGCTGTGCAA
ATGGAGATTCAGTTCAAAATAAAATCATTTAAAAACCTACATAAAAAGAACTCTAAACCCACCCCTGCAACAAAAGTCACTACATAAACT
GTTCAGCAGTATTCACCTATCAGAGTATTTGTTGTGAGTATAGATTATCAATTGAAAACACTACTCTTGTTTTCTTAATTGTACAGTTTT
CAATGTCCCTTTCTTAAAGAGACAGTATATTTCTCTTCACCCCTAGCCCATCTTCCCTCACCCTCCTGAATGACATCAGGAGGTATATCC
AGGGTGTCTCCTTCCTTCCTACTCTCTTGACCAGAAGTTAACAGACTATACTGTCTCTTTAAAAATAAAATTTAAAAAGCTTTGTTGTCT
TTTCAGACATACATATGCATATATGTTTTAGATGTTCTTATAAGAGAAAAGATGGTTTTTAAATGTGCCAAGTTGTGTGTGTGTGTGTAT
ATATATGTGTGTATGTGTGTGTATATATATATGTGTGTGTGTATATATATACACACACACACACACACCTGCTGTGTGATTGGTAAGCAA
TACAATAGTAAACATGTCCCCATTACTTTTTTCTAATATTGGACCAATGCTGTCCTAATTGTACATTTCCCCTTATGGTGACGATGCTCT
GACTCGTTTAGGTAGACACATTGACCACCTTCCATTCCATTAAATATTTTTTCCTTTTTCCCCTTTCTGTGTCATTCTTGAGGAAAAAAC

>In-frame_CDKAL1_ENST00000378624_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_5193nt
AAATAAACGTGGCGGGACGTATGTGTCATGGCGCTCTCCATCTAAAGTCTGTGCAGCTTCCGGAGAGTGGCGGGTTGATTTTCTCACTTT
GGACTGGTTTTTACTTCCCGACTTCTGGACTCATCTTTCAAGAGGACTTTAGACTAATTGCAGATAATTAAGAGAATATGCCTTCTGCAT
CCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAGGCATTTTGTAAGAAAGGATGTTG
TCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGACAGAAAATGCATCCGATGCAGAT
TTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGACCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAA
ATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGACTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATAGATCGT
GTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCA
CGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAATCATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTACTGCAAA
ACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGAACTAGTAGATAGAGCCAAACAATCTTTTCAAGGAAAGTATCTAAGA
CAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGGAAACACAATCAGCTATACAAAAAGCCAGATGTCCCACTATAT
AAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTAACTGTAAGAAGCCAGATGATGAC
ACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCTGAGTGTTCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGT
AACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCC
CTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGTGAACAGGAGTTCAGGAACAGGATGATTGAGCAGTATCATAAT
CACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATGAGGCCCGATTCATCAACCATAGC
TGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATACCGGATTGGACTCTATGCTCTTAAAGACATGCCAGCTGGGACT
GAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATC
GGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGCCAGCCCATGGCCACACACAAAAAATCTGGACGGTCAAAAGAG
AAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATATCAACACCCCAACTAGATTGACC
CCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTGTTAAAGCATCATGTATTCTTGGTCCGAAACTGGGAGAAGATT
CGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCACTCAGCATCATTATATACCCGTTGGAATGGGATCTGCCGAGATGAT
GGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAGACAGCTCGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAG
GAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCATCTCTTATAAAGATTCTTCCCGG
CAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAATGCTGATTATTATGAGAAGATCTCTGATCCCCTAGATCTTATC
ACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAG
TACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGAAAGGCCTATTACAATGCCCGGCATGAGGCATCAGCCCAGATT
GATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGAATGGGCATGAGAAGGACGACGAT
GTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCATGATCCAGTGTGACAAGTGCATGGTATGGCAGCACTGTGATTGTATG
GGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCAC
TATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGACTTGCTGCTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGAT
AGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCTCACATTAACCGAGATAAACTTGACATCTTTCGCATT
GAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCACCATTATTTCCGTCCCCACGAAACACACCACTCTCCATCCCGT
CGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTT
TATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTGTACATCTGTGATTATCGGCTTGACAAGTCAGCACACCTGTTT
TACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTC
TCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCATCCTGGAAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTG
GGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCA
GAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACAGAGGAAAGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAG
GAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTGGAAAAAATGCCATTGATGTGACC
TACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTGTTTATCCCAGAAAACAGCTTTCGAAAGTGACCCTCAAAGAAT
GAGAACCTCAAGCATCTGGGATCCAGTGGAGCTAATCAGTCCTGCCTCCTGCTCTCTGGGTATAGACAGGGGTGGGAAGGGTCCATCTGG
GCAAGGGGAATGGGGCCATGTTGTTGACATTAGGTACTTAATAAGCCTTGGAGCTAGTGGAGAGGGAGAGGAAAGGGTTCTGTCCAAGAC
AGTTCAGGTTAATTAATTTTCTTCTCCATTGCTTCACCTTAAGGGTTAATAATGTAGAGAGGAGGGAGGACCACATTGATGACCAGAACC
TACTGGTACTTTATAGCATTTGCCCCACCCCACAGCTTAGGTTTTTCTGTCATCCTCAGATCCCACAGGCATTGCGAAGAAGCTGCTTCC
TATACCCAGGTATAACTCAAAATCCAAAGGGATAGGGCCAGGATCCCTATTCCTACCCCATCTATTCTCTGTTGGCTCCAAGAGCTACCC
CAGAGACCTTAAACAGAAACAGTAGCTGAGGCTTCTTCCTAGATACCTGACTAGGGAAGTTTGTCTCTCCTTTCTTGCCCAACCAGGTCA
AAGTAAAATGTGAGTTGACAGCTCAAAGCACTTGTAACTGCTGCCCCCTCCCTACCTCTACTCCCCAAAATGGAATCATGGGATAGGGAA
GGCCCCCATGGGGTCAGAAGGGCACGGTAGTTCTTGCAATTATTTTTGTTTTACCCTTCATAACCTGTCAAACATATTTTTTTCTAATGA
GAAAGCCAGGCCCCCGCCAGCACACATGCTGTTTTTAATGCGCTGTAGTTCTTGTGTGTCTGCTGTGCTGTGCAAATGGAGATTCAGTTC
AAAATAAAATCATTTAAAAACCTACATAAAAAGAACTCTAAACCCACCCCTGCAACAAAAGTCACTACATAAACTGTTCAGCAGTATTCA
CCTATCAGAGTATTTGTTGTGAGTATAGATTATCAATTGAAAACACTACTCTTGTTTTCTTAATTGTACAGTTTTCAATGTCCCTTTCTT
AAAGAGACAGTATATTTCTCTTCACCCCTAGCCCATCTTCCCTCACCCTCCTGAATGACATCAGGAGGTATATCCAGGGTGTCTCCTTCC
TTCCTACTCTCTTGACCAGAAGTTAACAGACTATACTGTCTCTTTAAAAATAAAATTTAAAAAGCTTTGTTGTCTTTTCAGACATACATA
TGCATATATGTTTTAGATGTTCTTATAAGAGAAAAGATGGTTTTTAAATGTGCCAAGTTGTGTGTGTGTGTGTATATATATGTGTGTATG
TGTGTGTATATATATATGTGTGTGTGTATATATATACACACACACACACACACCTGCTGTGTGATTGGTAAGCAATACAATAGTAAACAT
GTCCCCATTACTTTTTTCTAATATTGGACCAATGCTGTCCTAATTGTACATTTCCCCTTATGGTGACGATGCTCTGACTCGTTTAGGTAG
ACACATTGACCACCTTCCATTCCATTAAATATTTTTTCCTTTTTCCCCTTTCTGTGTCATTCTTGAGGAAAAAACAAAAGAGAGAGGGGA

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000368346_chr1_155349907_-_5164nt
GGTAGAGAATATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAG
GCATTTTGTAAGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGA
CAGCACTATTCCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCT
AGCTGCTTATGGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGA
CCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGA
CTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAG
ACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAAT
CATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGA
ACTAGTAGATAGAGCCAAACAATCTTTTCAAGTGTTTTTTGTTTCAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTA
TGATATCCTTTGGCAGTGGAAACACAATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGA
TGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTAACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCT
CAATAGAATGATCTTTGCTGAGTGTTCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGT
GCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATA
CCTAGGGGAGGTCGTCAGTGAACAGGAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGA
TAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATGAGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATG
GTCTGTTAATGGAGTATACCGGATTGGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTC
CTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACT
CACCAGCAGCAAAAACAGCCAGCCCATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAA
AAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATATCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAA
TCGTGAAAGGAACTTTGTGTTAAAGCATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACAC
CAGTGATAATATTCACTCAGCATCATTATATACCCGTTGGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGAC
CCAGTTCTCTGCCCTGCAGACAGCTCGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCG
CCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCATCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCT
TCCCCCAAAGAAAAAGAATGCTGATTATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTA
CTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAG
AGATGTTTGTCGTCTACGAAAGGCCTATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGA
GGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGAATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAA
GGATGAAGGTCTCATGATCCAGTGTGACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCT
TTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCAT
CTGTTTGCTCCGAGATGACTTGCTGCTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGT
CCGTCAGTCCTATCGACTGTTATCTCACATTAACCGAGATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGA
ACGGTTTGCCTTTGGTCACCATTATTTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGT
GCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGG
AGTAAAGGAGCAAGATGTGTACATCTGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGT
CTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAA
GAGGAATGGAGGACGATCATCCTGGAAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGAT
TGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAG
TGAGGGTGAAAAAAAAACAGAGGAAAGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACT
CAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTGGAAAAAATGCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAA
ACTGCGAAGGCGTACTTTGTTTATCCCAGAAAACAGCTTTCGAAAGTGACCCTCAAAGAATGAGAACCTCAAGCATCTGGGATCCAGTGG
AGCTAATCAGTCCTGCCTCCTGCTCTCTGGGTATAGACAGGGGTGGGAAGGGTCCATCTGGGCAAGGGGAATGGGGCCATGTTGTTGACA
TTAGGTACTTAATAAGCCTTGGAGCTAGTGGAGAGGGAGAGGAAAGGGTTCTGTCCAAGACAGTTCAGGTTAATTAATTTTCTTCTCCAT
TGCTTCACCTTAAGGGTTAATAATGTAGAGAGGAGGGAGGACCACATTGATGACCAGAACCTACTGGTACTTTATAGCATTTGCCCCACC
CCACAGCTTAGGTTTTTCTGTCATCCTCAGATCCCACAGGCATTGCGAAGAAGCTGCTTCCTATACCCAGGTATAACTCAAAATCCAAAG
GGATAGGGCCAGGATCCCTATTCCTACCCCATCTATTCTCTGTTGGCTCCAAGAGCTACCCCAGAGACCTTAAACAGAAACAGTAGCTGA
GGCTTCTTCCTAGATACCTGACTAGGGAAGTTTGTCTCTCCTTTCTTGCCCAACCAGGTCAAAGTAAAATGTGAGTTGACAGCTCAAAGC
ACTTGTAACTGCTGCCCCCTCCCTACCTCTACTCCCCAAAATGGAATCATGGGATAGGGAAGGCCCCCATGGGGTCAGAAGGGCACGGTA
GTTCTTGCAATTATTTTTGTTTTACCCTTCATAACCTGTCAAACATATTTTTTTCTAATGAGAAAGCCAGGCCCCCGCCAGCACACATGC
TGTTTTTAATGCGCTGTAGTTCTTGTGTGTCTGCTGTGCTGTGCAAATGGAGATTCAGTTCAAAATAAAATCATTTAAAAACCTACATAA
AAAGAACTCTAAACCCACCCCTGCAACAAAAGTCACTACATAAACTGTTCAGCAGTATTCACCTATCAGAGTATTTGTTGTGAGTATAGA
TTATCAATTGAAAACACTACTCTTGTTTTCTTAATTGTACAGTTTTCAATGTCCCTTTCTTAAAGAGACAGTATATTTCTCTTCACCCCT
AGCCCATCTTCCCTCACCCTCCTGAATGACATCAGGAGGTATATCCAGGGTGTCTCCTTCCTTCCTACTCTCTTGACCAGAAGTTAACAG
ACTATACTGTCTCTTTAAAAATAAAATTTAAAAAGCTTTGTTGTCTTTTCAGACATACATATGCATATATGTTTTAGATGTTCTTATAAG
AGAAAAGATGGTTTTTAAATGTGCCAAGTTGTGTGTGTGTGTGTATATATATGTGTGTATGTGTGTGTATATATATATGTGTGTGTGTAT
ATATATACACACACACACACACACCTGCTGTGTGATTGGTAAGCAATACAATAGTAAACATGTCCCCATTACTTTTTTCTAATATTGGAC
CAATGCTGTCCTAATTGTACATTTCCCCTTATGGTGACGATGCTCTGACTCGTTTAGGTAGACACATTGACCACCTTCCATTCCATTAAA
TATTTTTTCCTTTTTCCCCTTTCTGTGTCATTCTTGAGGAAAAAACAAAAGAGAGAGGGGATGCCAATGATCCCCTTGAGCAGAGAAAAA

>In-frame_CDKAL1_ENST00000378610_chr6_20846409_+_ASH1L_ENST00000392403_chr1_155349907_-_5149nt
GGTAGAGAATATGCCTTCTGCATCCTGTGATACACTACTGGATGACATCGAAGATATCGTGTCTCAGGAAGATTCAAAACCACAAGATAG
GCATTTTGTAAGAAAGGATGTTGTCCCGAAGGTACGAAGGCGAAATACCCAAAAATATTTGCAAGAGGAAGAAAACAGTCCACCAAGTGA
CAGCACTATTCCAGGCATACAGAAAATTTGGATACGAACATGGGGTTGTTCTCATAATAATTCAGATGGAGAATATATGGCTGGACAGCT
AGCTGCTTATGGCTATAAAATTACAGAAAATGCATCCGATGCAGATTTATGGCTCCTGAACAGTTGCACTGTAAAAAACCCAGCTGAAGA
CCACTTTAGAAACTCAATTAAAAAAGCTCAAGAGGAGAACAAGAAAATCGTACTGGCTGGATGCGTTCCTCAAGCCCAGCCTCGCCAGGA
CTACCTTAAGGGACTGAGTATCATTGGGGTTCAGCAGATAGATCGTGTGGTAGAAGTTGTGGAGGAGACAATTAAAGGTCACTCTGTGAG
ACTGCTGGGTCAGAAAAAGGATAATGGAAGGCGGCTTGGGGGAGCACGATTGGATTTGCCGAAGATTAGGAAGAATCCACTGATAGAAAT
CATTTCCATCAATACCGGGTGTCTCAATGCTTGTACCTACTGCAAAACTAAACACGCCAGAGGAAATTTGGCCAGTTATCCAATTGATGA
ACTAGTAGATAGAGCCAAACAATCTTTTCAAGGAAAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCA
GTGGAAACACAATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAATGTCTACGTTGATGTCAAACCCCTTTC
TGGTTACGAAGCTACCACCTGTAACTGTAAGAAGCCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTT
TGCTGAGTGTTCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGGCATGAATGGGTGCAATGTCTAGAACG
ATTTCGAGCTGAGGAAAAAGGTTGGGGAATCAGAACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGT
CAGTGAACAGGAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGCCTGAACCTGGATAGTGGGATGGTGAT
TGACAGTTACCGCATGGGAAATGAGGCCCGATTCATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGT
ATACCGGATTGGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTATAACTTTCATTCCTTCAATGTGGAAAA
ACAGCAACTTTGTAAGTGTGGCTTTGAGAAATGTCGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAA
CAGCCAGCCCATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCACAAGCTGAAGAAAAGGAGAGGCCATCT
CTCTGAGGAACCCAGTGAAAATATCAACACCCCAACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTT
TGTGTTAAAGCATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAAGTAAAGCACACCAGTGATAATATTCA
CTCAGCATCATTATATACCCGTTGGAATGGGATCTGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCT
GCAGACAGCTCGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCTCGGGCAGCCCGCCTAGCCCAGATCTT
CAAAGAAATTTGTGATGGTATCATCTCTTATAAAGATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAA
GAATGCTGATTATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATCCTCACTGGTTACTATAAGACAGTGGA
AGCTTTTGATGCTGACATGCTCAAAGTCTTTCGGAATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCT
ACGAAAGGCCTATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAGACAGCAAGTGAGGCAGACAGCAGTGA
GACCTCAGTCTCTGAAAAGGAGAATGGGCATGAGAAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAAGGATGAAGGTCTCAT
GATCCAGTGTGACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTGGAGCACTACCTTTGTGAGCAGTGTGA
CCCAAGGCCTGTGGACAGGGAGGTTCCCATGATCCCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGA
TGACTTGCTGCTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGATGGCCACCCGGTCCGTCAGTCCTATCG
ACTGTTATCTCACATTAACCGAGATAAACTTGACATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGG
TCACCATTATTTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAACTATTTCGGGTGCCACTCTATGAGAT
CATTCCCTTGGAGGCTGTAGTGGGGACCTGCTGTGTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGA
TGTGTACATCTGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAACCGCTATCCTGTCTGCACCAAACCCTA
TGCTTTTGATCACTTCCCCAAGAAGCTCACTCCCAAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACG
ATCATCCTGGAAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCTCTACCCTTGATTGAAGAGGTTCTAGC
CAGTCAAGAGCAAGCAGCCAATGAGATACCCAGCCTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAA
AACAGAGGAAAGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAACGGGAACGACTCAACCAGATCTTGCT
CAATCTCCTTGAAAAAATCCCTGGAAAAAATGCCATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTAC
TTTGTTTATCCCAGAAAACAGCTTTCGAAAGTGACCCTCAAAGAATGAGAACCTCAAGCATCTGGGATCCAGTGGAGCTAATCAGTCCTG
CCTCCTGCTCTCTGGGTATAGACAGGGGTGGGAAGGGTCCATCTGGGCAAGGGGAATGGGGCCATGTTGTTGACATTAGGTACTTAATAA
GCCTTGGAGCTAGTGGAGAGGGAGAGGAAAGGGTTCTGTCCAAGACAGTTCAGGTTAATTAATTTTCTTCTCCATTGCTTCACCTTAAGG
GTTAATAATGTAGAGAGGAGGGAGGACCACATTGATGACCAGAACCTACTGGTACTTTATAGCATTTGCCCCACCCCACAGCTTAGGTTT
TTCTGTCATCCTCAGATCCCACAGGCATTGCGAAGAAGCTGCTTCCTATACCCAGGTATAACTCAAAATCCAAAGGGATAGGGCCAGGAT
CCCTATTCCTACCCCATCTATTCTCTGTTGGCTCCAAGAGCTACCCCAGAGACCTTAAACAGAAACAGTAGCTGAGGCTTCTTCCTAGAT
ACCTGACTAGGGAAGTTTGTCTCTCCTTTCTTGCCCAACCAGGTCAAAGTAAAATGTGAGTTGACAGCTCAAAGCACTTGTAACTGCTGC
CCCCTCCCTACCTCTACTCCCCAAAATGGAATCATGGGATAGGGAAGGCCCCCATGGGGTCAGAAGGGCACGGTAGTTCTTGCAATTATT
TTTGTTTTACCCTTCATAACCTGTCAAACATATTTTTTTCTAATGAGAAAGCCAGGCCCCCGCCAGCACACATGCTGTTTTTAATGCGCT
GTAGTTCTTGTGTGTCTGCTGTGCTGTGCAAATGGAGATTCAGTTCAAAATAAAATCATTTAAAAACCTACATAAAAAGAACTCTAAACC
CACCCCTGCAACAAAAGTCACTACATAAACTGTTCAGCAGTATTCACCTATCAGAGTATTTGTTGTGAGTATAGATTATCAATTGAAAAC
ACTACTCTTGTTTTCTTAATTGTACAGTTTTCAATGTCCCTTTCTTAAAGAGACAGTATATTTCTCTTCACCCCTAGCCCATCTTCCCTC
ACCCTCCTGAATGACATCAGGAGGTATATCCAGGGTGTCTCCTTCCTTCCTACTCTCTTGACCAGAAGTTAACAGACTATACTGTCTCTT
TAAAAATAAAATTTAAAAAGCTTTGTTGTCTTTTCAGACATACATATGCATATATGTTTTAGATGTTCTTATAAGAGAAAAGATGGTTTT
TAAATGTGCCAAGTTGTGTGTGTGTGTGTATATATATGTGTGTATGTGTGTGTATATATATATGTGTGTGTGTATATATATACACACACA
CACACACACCTGCTGTGTGATTGGTAAGCAATACAATAGTAAACATGTCCCCATTACTTTTTTCTAATATTGGACCAATGCTGTCCTAAT
TGTACATTTCCCCTTATGGTGACGATGCTCTGACTCGTTTAGGTAGACACATTGACCACCTTCCATTCCATTAAATATTTTTTCCTTTTT
CCCCTTTCTGTGTCATTCTTGAGGAAAAAACAAAAGAGAGAGGGGATGCCAATGATCCCCTTGAGCAGAGAAAAAGCAAAATAAATATTT


Top

FusionGenePPI for CDKAL1_ASH1L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDKAL1ELAVL1, MMS19, LMNA, FAM96B, CIAO1, LCK, SUZ12, TCTN2, TCTN3, EVC2, NEK8, TMEM237, TMEM17, TMEM216, FAF2, TTYH3, BPIFB1, DNM1, TYW3, DNM3, TYW1BASH1LHIST1H3A, H3F3A, SMAD7, THAP7, MORF4L1, PARD6A, SIKE1, MORF4L2, NXF2, CDX1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDKAL1_ASH1L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDKAL1_ASH1L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCDKAL1C0011860Diabetes Mellitus, Non-Insulin-Dependent3CTD_human
HgeneCDKAL1C0005910Body Weight2CTD_human
HgeneCDKAL1C0005612Birth Weight1CTD_human
TgeneASH1LC0023903Liver neoplasms1CTD_human