FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6562

FusionGeneSummary for CDK5RAP2_AVEN

check button Fusion gene summary
Fusion gene informationFusion gene name: CDK5RAP2_AVEN
Fusion gene ID: 6562
HgeneTgene
Gene symbol

CDK5RAP2

AVEN

Gene ID

55755

57099

Gene nameCDK5 regulatory subunit associated protein 2apoptosis and caspase activation inhibitor
SynonymsC48|Cep215|MCPH3PDCD12
Cytomap

9q33.2

15q14

Type of geneprotein-codingprotein-coding
DescriptionCDK5 regulatory subunit-associated protein 2CDK5 activator-binding protein C48centrosomal protein 215 kDacentrosomincell death regulator Avenapoptosis, caspase activation inhibitorprogrammed cell death 12
Modification date2018051920180519
UniProtAcc

Q96SN8

Q9NQS1

Ensembl transtripts involved in fusion geneENST00000360822, ENST00000359309, 
ENST00000349780, ENST00000360190, 
ENST00000480467, 
ENST00000306730, 
ENST00000558136, 
Fusion gene scores* DoF score9 X 8 X 4=2884 X 2 X 4=32
# samples 94
** MAII scorelog2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CDK5RAP2 [Title/Abstract] AND AVEN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDK5RAP2

GO:0000226

microtubule cytoskeleton organization

17959831

HgeneCDK5RAP2

GO:0001578

microtubule bundle formation

19553473

HgeneCDK5RAP2

GO:0045893

positive regulation of transcription, DNA-templated

19282672

HgeneCDK5RAP2

GO:0090266

regulation of mitotic cell cycle spindle assembly checkpoint

19282672

TgeneAVEN

GO:0043066

negative regulation of apoptotic process

10949025


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-2562-01ACDK5RAP2chr9

123199573

-AVENchr15

34168196

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360822ENST00000306730CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
5CDS-5UTRENST00000360822ENST00000558136CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
In-frameENST00000359309ENST00000306730CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
5CDS-5UTRENST00000359309ENST00000558136CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
In-frameENST00000349780ENST00000306730CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
5CDS-5UTRENST00000349780ENST00000558136CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
In-frameENST00000360190ENST00000306730CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
5CDS-5UTRENST00000360190ENST00000558136CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
intron-3CDSENST00000480467ENST00000306730CDK5RAP2chr9

123199573

-AVENchr15

34168196

-
intron-5UTRENST00000480467ENST00000558136CDK5RAP2chr9

123199573

-AVENchr15

34168196

-

Top

FusionProtFeatures for CDK5RAP2_AVEN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDK5RAP2

Q96SN8

AVEN

Q9NQS1

Protects against apoptosis mediated by Apaf-1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAVENchr9:123199573chr15:34168196ENST00000306730-165_85148363Compositional biasNote=Ala/Gly-rich


Top

FusionGeneSequence for CDK5RAP2_AVEN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDK5RAP2_ENST00000360822_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_1501aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRITFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDTETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEV
NEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCTLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDTEELIQVLKKEQDITTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSTQNLRKTLEEQISEIRRREEESFSLTSDQT
STLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELTTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTEIMKDLSKGGCKNGYLRHT
ESKISDCDGAHAPGCLEEGAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLTEQEVSGEHLDGKTEKTPKQKGELVHFVQTNSF
SKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPINTALSAEHRPENLHGVPGWQAALLSLPGITNRE
AKKSRLPILIKPSRSLGNMTRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPG
EQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVATYLSSKSQPSAKVSVMGTDQSESINTSNETEYL
KQKIHDLETELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLENL
KQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDY
CVAEGFQEQLNQCAELLEKLEKLFLNGDSFSQFRFAEEKEWDSEASCPKQNSAFTVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVP
QVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNI

>In-frame_CDK5RAP2_ENST00000359309_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_1492aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRITFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDTETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEV
NEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCTLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDTEELIQVLKKEQDITTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSTQNLRKTLEEQISEIRRREEESFSLTSDQT
STLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELTTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDE
INFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLT
EQEVSGEHLDGKTEKTPKQKGELVHFVQTNSFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPIN
TALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMTRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLI
LAEAVMEGRPTPDKTLLNDSEICPPDDLASLPSCKENPEDVLSPTSVATYLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLET
ELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLENLKQQLEEQEY
KLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQ
LNQCAELLEKLEKLFLNGDSFSQFRFAEEKEWDSEASCPKQNSAFTVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDD
GKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDL

>In-frame_CDK5RAP2_ENST00000349780_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_1533aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRITFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDTETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEV
NEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCTLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDTEELIQVLKKEQDITTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSTQNLRKTLEEQISEIRRREEESFSLTSDQT
STLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELTTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDE
INFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLT
EQEVSGEHLDGKTEKTPKQKGELVHFVQTNSFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPIN
TALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMTRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLI
LAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVAT
YLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMT
FSSLHQVRYVKHVKILGPLAPEMIDSRVLENLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQI
KDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGDSFSQFRFAEEKEWDSEASCPKQNSAFTVDS
ELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQK
PTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSM

>In-frame_CDK5RAP2_ENST00000360190_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_1533aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRITFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDTETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRDLRNEVEKLRNEV
NEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCTLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDTEELIQVLKKEQDITTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSTQNLRKTLEEQISEIRRREEESFSLTSDQT
STLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELTTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDE
INFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLT
EQEVSGEHLDGKTEKTPKQKGELVHFVQTNSFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPIN
TALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMTRLPATQEVVTQLQSQILELQGELKEFKTCNKQLHQKLI
LAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVAT
YLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMT
FSSLHQVRYVKHVKILGPLAPEMIDSRVLENLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQI
KDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGDSFSQFRFAEEKEWDSEASCPKQNSAFTVDS
ELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQK
PTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDK5RAP2_ENST00000360822_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_4503nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGGCACACG
GAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTGTTCAAT
GAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACAGAGCAG
GAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAACTCATTT
TCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGATGCCTCA
GTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAACACTGCA
CTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAACAGAGAG
GCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTGGTGACG
CAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATTCTGGCT
GAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGCCCAGGA
GAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGACTCTGAG
ATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACTTACCTG
AGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAATACTTA
AAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGTGAGGCC
ATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACCTTTTCA
AGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAGAACCTC
AAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTGCAGAAT
AAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATTAAGGAT
GGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTGGATTAC
TGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGACTCATTC
TCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGTGAGTTA
TTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAGGTTCCT
CAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCCATCTTT
GAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAACCCACT
TCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGATAACATC
TTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCTGTGACT
GAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATGATTTCC

>In-frame_CDK5RAP2_ENST00000359309_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_4476nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGAG
ATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGG
CACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTG
TTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACA
GAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAAC
TCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGAT
GCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAAC
ACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAAC
AGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTG
GTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATT
CTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGACTCTGAGATTTGCCCACCTGATGACCTTGCCAGC
TTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACTTACCTGAGTTCCAAGAGTCAGCCTTCTGCTAAA
GTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAATACTTAAAACAGAAAATCCATGACTTGGAAACT
GAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGTGAGGCCATAATTACAGTTTTGTGTGGGACAGAA
GGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACCTTTTCAAGTTTGCACCAAGTGCGATACGTGAAA
CACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAGAACCTCAAACAGCAGCTGGAGGAACAGGAATAC
AAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTGCAGAATAAGTTCAGAGATCTCTCACCTCCCAGA
TACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATTAAGGATGGCCATGGCATCTGTGTCATCTCCCGT
CAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTGGATTACTGTGTGGCCGAGGGTTTCCAGGAACAG
CTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGACTCATTCTCACAGTTCCGGTTTGCTGAGGAGAAA
GAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGTGAGTTATTGGTTCGAGCCCTTCAAGAGCTGCCT
CTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAGGTTCCTCAGGTGAAACCAAAGAGAACTGATGAT
GGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCCATCTTTGAGCTGAAATCTGTGGCTGCTGGCTGC
CCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAACCCACTTCCCCACTGCAGTCAGCAGGAGACCAT
TTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGATAACATCTTACCAGATCAGACGTCTCAGGACCTG
AAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCTGTGACTGAAGAAAAAAACATGGAACCTGAGCAA

>In-frame_CDK5RAP2_ENST00000349780_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_4599nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGAG
ATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGG
CACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTG
TTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACA
GAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAAC
TCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGAT
GCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAAC
ACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAAC
AGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTG
GTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATT
CTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGC
CCAGGAGAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGAC
TCTGAGATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACT
TACCTGAGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAA
TACTTAAAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGT
GAGGCCATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACC
TTTTCAAGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAG
AACCTCAAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTG
CAGAATAAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATT
AAGGATGGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTG
GATTACTGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGAC
TCATTCTCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGT
GAGTTATTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAG
GTTCCTCAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCC
ATCTTTGAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAA
CCCACTTCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGAT
AACATCTTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCT
GTGACTGAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATG

>In-frame_CDK5RAP2_ENST00000360190_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_4599nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGAG
ATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGG
CACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTG
TTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACA
GAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAAC
TCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGAT
GCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAAC
ACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAAC
AGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTG
GTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATT
CTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGC
CCAGGAGAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGAC
TCTGAGATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACT
TACCTGAGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAA
TACTTAAAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGT
GAGGCCATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACC
TTTTCAAGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAG
AACCTCAAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTG
CAGAATAAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATT
AAGGATGGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTG
GATTACTGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGAC
TCATTCTCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGT
GAGTTATTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAG
GTTCCTCAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCC
ATCTTTGAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAA
CCCACTTCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGAT
AACATCTTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCT
GTGACTGAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDK5RAP2_ENST00000360822_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_5070nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGT
GAATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAA
ACATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTT
AATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTT
CTCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATC
TCTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTC
ATATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAAC
ATCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCT
TATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGG
GTTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGGCACAC
GGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTGTTCAA
TGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACAGAGCA
GGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAACTCATT
TTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGATGCCTC
AGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAACACTGC
ACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAACAGAGA
GGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTGGTGAC
GCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATTCTGGC
TGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGCCCAGG
AGAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGACTCTGA
GATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACTTACCT
GAGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAATACTT
AAAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGTGAGGC
CATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACCTTTTC
AAGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAGAACCT
CAAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTGCAGAA
TAAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATTAAGGA
TGGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTGGATTA
CTGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGACTCATT
CTCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGTGAGTT
ATTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAGGTTCC
TCAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCCATCTT
TGAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAACCCAC
TTCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGATAACAT
CTTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCTGTGAC
TGAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATGATTTC
CTAAAAAGGGGAAAAAAAGTGCCTGAAGCAAATCTTGGTTGCCTTCTAACGGCAGGTGGGCATAAGGCTGTCCTTCAGGACCAGCCAGTT
TACAAGCATGTCTCAAGCTAGTGTGTTCCATTATGCTCACAGCAGTAAATGCCTACCTCTGTGTTTGACATCTGAAAGAATACATTGAAG
CAGCTTGTTGCATTTGTTTTTCTGGCTTAGTAATCTAATAGATTTCCTTAAGGGCAGGAGATAGACTCTGGCCCTTGTTTCTAGCCTCCT
TCCTTGCAGTGTTTACAACATAGCCAGTGTTTACAGCATAGCAGATGCTGCTGCTGATTAAGAGAATAGATGCAAACAAGGCATGCATTT

>In-frame_CDK5RAP2_ENST00000359309_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_5043nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGT
GAATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAA
ACATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTT
AATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTT
CTCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATC
TCTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTC
ATATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAAC
ATCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCT
TATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGG
GTTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGA
GATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAG
GCACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTT
GTTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGAC
AGAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAA
CTCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGA
TGCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAA
CACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAA
CAGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGT
GGTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAAT
TCTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGACTCTGAGATTTGCCCACCTGATGACCTTGCCAG
CTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACTTACCTGAGTTCCAAGAGTCAGCCTTCTGCTAA
AGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAATACTTAAAACAGAAAATCCATGACTTGGAAAC
TGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGTGAGGCCATAATTACAGTTTTGTGTGGGACAGA
AGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACCTTTTCAAGTTTGCACCAAGTGCGATACGTGAA
ACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAGAACCTCAAACAGCAGCTGGAGGAACAGGAATA
CAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTGCAGAATAAGTTCAGAGATCTCTCACCTCCCAG
ATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATTAAGGATGGCCATGGCATCTGTGTCATCTCCCG
TCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTGGATTACTGTGTGGCCGAGGGTTTCCAGGAACA
GCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGACTCATTCTCACAGTTCCGGTTTGCTGAGGAGAA
AGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGTGAGTTATTGGTTCGAGCCCTTCAAGAGCTGCC
TCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAGGTTCCTCAGGTGAAACCAAAGAGAACTGATGA
TGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCCATCTTTGAGCTGAAATCTGTGGCTGCTGGCTG
CCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAACCCACTTCCCCACTGCAGTCAGCAGGAGACCA
TTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGATAACATCTTACCAGATCAGACGTCTCAGGACCT
GAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCTGTGACTGAAGAAAAAAACATGGAACCTGAGCA
ACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATGATTTCCTAAAAAGGGGAAAAAAAGTGCCTGAA
GCAAATCTTGGTTGCCTTCTAACGGCAGGTGGGCATAAGGCTGTCCTTCAGGACCAGCCAGTTTACAAGCATGTCTCAAGCTAGTGTGTT
CCATTATGCTCACAGCAGTAAATGCCTACCTCTGTGTTTGACATCTGAAAGAATACATTGAAGCAGCTTGTTGCATTTGTTTTTCTGGCT
TAGTAATCTAATAGATTTCCTTAAGGGCAGGAGATAGACTCTGGCCCTTGTTTCTAGCCTCCTTCCTTGCAGTGTTTACAACATAGCCAG
TGTTTACAGCATAGCAGATGCTGCTGCTGATTAAGAGAATAGATGCAAACAAGGCATGCATTTGGCCAAAATAAACAAATGCTGGTCTGT

>In-frame_CDK5RAP2_ENST00000349780_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_5165nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGAG
ATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGG
CACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTG
TTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACA
GAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAAC
TCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGAT
GCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAAC
ACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAAC
AGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTG
GTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATT
CTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGC
CCAGGAGAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGAC
TCTGAGATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACT
TACCTGAGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAA
TACTTAAAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGT
GAGGCCATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACC
TTTTCAAGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAG
AACCTCAAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTG
CAGAATAAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATT
AAGGATGGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTG
GATTACTGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGAC
TCATTCTCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGT
GAGTTATTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAG
GTTCCTCAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCC
ATCTTTGAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAA
CCCACTTCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGAT
AACATCTTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCT
GTGACTGAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATG
ATTTCCTAAAAAGGGGAAAAAAAGTGCCTGAAGCAAATCTTGGTTGCCTTCTAACGGCAGGTGGGCATAAGGCTGTCCTTCAGGACCAGC
CAGTTTACAAGCATGTCTCAAGCTAGTGTGTTCCATTATGCTCACAGCAGTAAATGCCTACCTCTGTGTTTGACATCTGAAAGAATACAT
TGAAGCAGCTTGTTGCATTTGTTTTTCTGGCTTAGTAATCTAATAGATTTCCTTAAGGGCAGGAGATAGACTCTGGCCCTTGTTTCTAGC
CTCCTTCCTTGCAGTGTTTACAACATAGCCAGTGTTTACAGCATAGCAGATGCTGCTGCTGATTAAGAGAATAGATGCAAACAAGGCATG

>In-frame_CDK5RAP2_ENST00000360190_chr9_123199573_-_AVEN_ENST00000306730_chr15_34168196_-_5165nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGATCTTAGAAATGAAGTTGAAAAATTACGCAATGAAGTG
AATGAAAGAGAGAAAGCAATGGAAAATCGTTACAAGAGTCTTCTGAGTGAAAGCAATAAAAAATTGCACAATCAAGAGCAAGTGATCAAA
CATCTAACAGAAAGTACCAATCAGAAGGACGTGTTGCTTCAGAAATTCAATGAAAAAGATTTGGAAGTAATACAGCAGAACTGCTATTTA
ATGGCTGCAGAGGATCTTGAGCTCAGGAGTGAAGGCTTAATAACAGAAAAGTGCTCTTCTCAACAGCCACCAGGCAGCAAAACCATCTTC
TCTAAGGAAAAGAAACAATCATCAGACTATGAAGAGCTGATTCAGGTCTTAAAGAAAGAGCAGGACATCTATACCCATCTGGTCAAATCT
CTGCAGGAATCAGACAGTATCAACAACCTGCAGGCTGAGTTAAACAAGATTTTTGCCCTGCGGAAGCAACTGGAGCAGGATGTGCTTTCA
TATCAGAATTTGCGGAAGACCTTGGAGGAGCAGATCAGCGAAATTCGGAGGCGGGAAGAAGAATCATTTTCACTTTATAGTGATCAAACA
TCTTATCTAAGTATTTGCCTTGAAGAAAACAATCGGTTTCAAGTGGAACATTTTTCTCAAGAAGAACTTAAGAAAAAGGTCAGTGACCTT
ATACAGCTAGTGAAGGAGCTGTATACAGACAACCAGCACCTGAAGAAAACCATTTTTGATCTCTCCTGCATGGGTTTCCAGGGAAATGGG
TTTCCAGATAGACTTGCGTCTACAGAACAAACAGAGCTTCTGGCTAGCAAGGAGGACGAGGACACGATCAAAATTGGGGAGGATGACGAG
ATTAATTTCCTGAGTGACCAGCATTTGCAGCAGAGTAATGAGATTATGAAAGACCTTTCCAAAGGAGGCTGCAAAAATGGATACTTAAGG
CACACGGAGTCTAAGATTTCAGATTGTGATGGGGCCCACGCACCTGGCTGCCTAGAAGAAGGTGCATTCATAAACCTGCTTGCCCCTTTG
TTCAATGAGAAGGCCACATTATTACTGGAATCCAGGCCAGACCTTCTGAAAGTGGTACGGGAACTGCTTCTGGGACAACTATTCTTGACA
GAGCAGGAAGTTTCTGGAGAACACCTTGATGGTAAAACTGAGAAGACACCTAAGCAAAAAGGTGAACTTGTACATTTTGTCCAAACCAAC
TCATTTTCCAAGCCACATGATGAACTGAAGTTGTCTTGTGAGGCCCAGCTAGTAAAGGCAGGCGAAGTGCCCAAGGTAGGACTGAAAGAT
GCCTCAGTGCAGACTGTGGCCACGGAGGGCGACCTGCTGAGATTCAAGCATGAAGCAACAAGAGAGGCTTGGGAAGAGAAACCGATCAAC
ACTGCACTCAGCGCAGAGCATCGGCCAGAGAACCTGCACGGGGTGCCTGGGTGGCAGGCTGCCCTCCTTTCCCTCCCTGGTATTACCAAC
AGAGAGGCTAAGAAGTCCCGCTTGCCAATCCTAATAAAACCATCCCGGTCATTAGGAAATATGTATCGTCTCCCTGCCACCCAGGAGGTG
GTGACGCAGCTGCAGAGCCAGATCTTGGAGCTGCAGGGGGAGCTGAAGGAGTTTAAAACTTGTAATAAGCAACTTCACCAAAAGTTAATT
CTGGCTGAAGCAGTGATGGAGGGGAGGCCAACGCCCGACAAAACGTTGCTGAATGCTCAGCCCCCTGTGGGAGCAGCCTACCAGGACAGC
CCAGGAGAGCAGAAAGGAATTAAAACCACATCTTCTGTCTGGAGAGACAAGGAAATGGACAGTGATCAGCAAAGAAGCTACGAGATTGAC
TCTGAGATTTGCCCACCTGATGACCTTGCCAGCTTGCCATCATGCAAAGAAAATCCTGAAGATGTTCTGAGCCCAACTTCAGTAGCTACT
TACCTGAGTTCCAAGAGTCAGCCTTCTGCTAAAGTCAGTGTGATGGGGACTGATCAGTCAGAGAGCATTAATACCTCAAATGAGACAGAA
TACTTAAAACAGAAAATCCATGACTTGGAAACTGAGCTGGAAGGCTACCAGAATTTCATATTTCAGCTTCAAAAGCACTCCCAGTGCAGT
GAGGCCATAATTACAGTTTTGTGTGGGACAGAAGGGGCCCAGGATGGCTTGAGCAAGCCCAAGAATGGTTCTGATGGGGAAGAAATGACC
TTTTCAAGTTTGCACCAAGTGCGATACGTGAAACACGTGAAAATCCTCGGTCCGCTGGCCCCAGAGATGATTGACAGCAGGGTGCTGGAG
AACCTCAAACAGCAGCTGGAGGAACAGGAATACAAGCTGCAGAAGGAGCAGAATTTGAACATGCAACTTTTCAGTGAGATCCATAATCTG
CAGAATAAGTTCAGAGATCTCTCACCTCCCAGATACGATTCATTAGTTCAGTCCCAAGCCAGGGAGCTCTCCCTTCAACGGCAGCAGATT
AAGGATGGCCATGGCATCTGTGTCATCTCCCGTCAACACATGAACACCATGATTAAGGCATTTGAGGAGTTGCTGCAGGCCAGTGATGTG
GATTACTGTGTGGCCGAGGGTTTCCAGGAACAGCTGAATCAATGTGCTGAGCTGCTGGAGAAATTGGAAAAGCTATTTCTCAACGGGGAC
TCATTCTCACAGTTCCGGTTTGCTGAGGAGAAAGAATGGGATAGTGAAGCTTCTTGTCCAAAACAGAATTCAGCATTTTATGTGGATAGT
GAGTTATTGGTTCGAGCCCTTCAAGAGCTGCCTCTCTGCCTCCGACTCAACGTTGCTGCCGAACTGGTCCAGGGTACAGTTCCTTTAGAG
GTTCCTCAGGTGAAACCAAAGAGAACTGATGATGGCAAGGGATTAGGGATGCAGTTAAAGGGGCCCTTGGGGCCTGGAGGAAGGGGGCCC
ATCTTTGAGCTGAAATCTGTGGCTGCTGGCTGCCCTGTGTTGCTGGGCAAAGACAACCCAAGCCCGGGTCCTTCAAGGGATTCTCAGAAA
CCCACTTCCCCACTGCAGTCAGCAGGAGACCATTTGGAAGAAGAACTAGATCTGTTGCTTAATTTAGATGCACCTATAAAAGAGGGAGAT
AACATCTTACCAGATCAGACGTCTCAGGACCTGAAATCCAAGGAAGATGGGGAGGTGGTCCAAGAGGAAGAAGTTTGTGCAAAACCATCT
GTGACTGAAGAAAAAAACATGGAACCTGAGCAACCAAGTACCTCCAAAAATGTTACCGAGGAAGAGCTGGAAGACTGGTTGGACAGCATG
ATTTCCTAAAAAGGGGAAAAAAAGTGCCTGAAGCAAATCTTGGTTGCCTTCTAACGGCAGGTGGGCATAAGGCTGTCCTTCAGGACCAGC
CAGTTTACAAGCATGTCTCAAGCTAGTGTGTTCCATTATGCTCACAGCAGTAAATGCCTACCTCTGTGTTTGACATCTGAAAGAATACAT
TGAAGCAGCTTGTTGCATTTGTTTTTCTGGCTTAGTAATCTAATAGATTTCCTTAAGGGCAGGAGATAGACTCTGGCCCTTGTTTCTAGC
CTCCTTCCTTGCAGTGTTTACAACATAGCCAGTGTTTACAGCATAGCAGATGCTGCTGCTGATTAAGAGAATAGATGCAAACAAGGCATG


Top

FusionGenePPI for CDK5RAP2_AVEN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDK5RAP2STARD9, MAGEH1, PTN, SENP2, ZPR1, C14orf1, HAP1, KAT5, LUC7L2, CRMP1, RBM48, EEF1G, CDK5R1, CDK5, ABCA2, STK36, TUBGCP6, TUBGCP5, TUBGCP2, TUBGCP3, NME7, MZT2A, MZT2B, TUBG1, PCNT, AKAP9, TSNAX, TRIM37, PCBD1, MAPRE1, FBXO25, PRKACA, PRKACB, SUZ12, SOCS6, MLF1, PRPS1, PRKAR2B, CARD9, DTNBP1, FGL2, C17orf59, CEP68, MUS81, PTTG1, PLK4, CEP192, CEP152, RPGRIP1L, DYNLL1, FGFR1OP, USP43, CHMP4B, SSH3, TPTE2, C1orf87, LPXN, PDE4DIP, IKBIP, LINC01587, FAM81B, SSX2, RALBP1, C6orf141AVENBCL2L1, BCL2, APAF1, MOV10, NXF1, XPO1, HNRNPU, RPL10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000349780-2538926_120813181894MAPRE1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000359309-2437926_120812771853MAPRE1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360190-2537926_120813181815MAPRE1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360822-2437926_120812861862MAPRE1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000349780-253858_19613181894NCKAP5L
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000359309-243758_19612771853NCKAP5L
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360190-253758_19613181815NCKAP5L
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360822-243758_19612861862NCKAP5L


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000349780-25381726_176813181894CDK5R1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000359309-24371726_176812771853CDK5R1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360190-25371726_176813181815CDK5R1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360822-24371726_176812861862CDK5R1
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000349780-25381726_189313181894PCNT and AKAP9
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000359309-24371726_189312771853PCNT and AKAP9
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360190-25371726_189313181815PCNT and AKAP9
HgeneCDK5RAP2chr9:123199573chr15:34168196ENST00000360822-24371726_189312861862PCNT and AKAP9


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDK5RAP2_AVEN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDK5RAP2_AVEN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAVENC0007131Non-Small Cell Lung Carcinoma1CTD_human