FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6502

FusionGeneSummary for CDK12_TAF15

check button Fusion gene summary
Fusion gene informationFusion gene name: CDK12_TAF15
Fusion gene ID: 6502
HgeneTgene
Gene symbol

CDK12

TAF15

Gene ID

51755

8148

Gene namecyclin dependent kinase 12TATA-box binding protein associated factor 15
SynonymsCRK7|CRKR|CRKRSNpl3|RBP56|TAF2N|TAFII68
Cytomap

17q12

17q12

Type of geneprotein-codingprotein-coding
Descriptioncyclin-dependent kinase 12CDC2-related protein kinase 7Cdc2-related kinase, arginine/serine-richcell division cycle 2-related protein kinase 7cell division protein kinase 12TATA-binding protein-associated factor 2NRBP56/CSMF fusionTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaTATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)TATA box-bin
Modification date2018052320180523
UniProtAcc

Q9NYV4

Q92804

Ensembl transtripts involved in fusion geneENST00000430627, ENST00000447079, 
ENST00000559545, 
ENST00000588240, 
ENST00000592237, ENST00000311979, 
Fusion gene scores* DoF score20 X 10 X 12=24007 X 5 X 6=210
# samples 227
** MAII scorelog2(22/2400*10)=-3.44745897697122
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDK12 [Title/Abstract] AND TAF15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDK12

GO:0046777

protein autophosphorylation

11683387


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-UY-A9PD-01ACDK12chr17

37682569

+TAF15chr17

34169371

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000430627ENST00000588240CDK12chr17

37682569

+TAF15chr17

34169371

+
In-frameENST00000430627ENST00000592237CDK12chr17

37682569

+TAF15chr17

34169371

+
In-frameENST00000430627ENST00000311979CDK12chr17

37682569

+TAF15chr17

34169371

+
In-frameENST00000447079ENST00000588240CDK12chr17

37682569

+TAF15chr17

34169371

+
In-frameENST00000447079ENST00000592237CDK12chr17

37682569

+TAF15chr17

34169371

+
In-frameENST00000447079ENST00000311979CDK12chr17

37682569

+TAF15chr17

34169371

+
intron-3CDSENST00000559545ENST00000588240CDK12chr17

37682569

+TAF15chr17

34169371

+
intron-3CDSENST00000559545ENST00000592237CDK12chr17

37682569

+TAF15chr17

34169371

+
intron-3CDSENST00000559545ENST00000311979CDK12chr17

37682569

+TAF15chr17

34169371

+

Top

FusionProtFeatures for CDK12_TAF15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDK12

Q9NYV4

TAF15

Q92804

Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II(POLR2A), thereby acting as a key regulator of transcriptionelongation. Regulates the expression of genes involved in DNArepair and is required for the maintenance of genomic stability.Preferentially phosphorylates 'Ser-5' in CTD repeats that arealready phosphorylated at 'Ser-7', but can also phosphorylate'Ser-2'. Required for RNA splicing, possibly by phosphorylatingSRSF1/SF2. Involved in regulation of MAP kinase activity, possiblyleading to affect the response to estrogen inhibitors.{ECO:0000269|PubMed:11683387, ECO:0000269|PubMed:19651820,ECO:0000269|PubMed:20952539, ECO:0000269|PubMed:22012619,ECO:0000269|PubMed:24662513}. RNA and ssDNA-binding protein that may play specificroles during transcription initiation at distinct promoters. Canenter the preinitiation complex together with the RNA polymeraseII (Pol II). {ECO:0000269|PubMed:19124016}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+1314407_41312531482Compositional biasNote=Poly-Ala
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+1314535_54012531482Compositional biasNote=Poly-Pro
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+1314407_41312531491Compositional biasNote=Poly-Ala
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+1314535_54012531491Compositional biasNote=Poly-Pro
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+1314727_102012531482DomainProtein kinase
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+1314727_102012531491DomainProtein kinase
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+1314733_74112531482Nucleotide bindingNote=ATP
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+1314814_81912531482Nucleotide bindingNote=ATP
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+1314733_74112531491Nucleotide bindingNote=ATP
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+1314814_81912531491Nucleotide bindingNote=ATP
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016320_590301590Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016320_590304593Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016407_575301590RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016407_575304593RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016407_413301590RepeatNote=1
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016414_420301590RepeatNote=2
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016421_429301590RepeatNote=3
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016430_439301590RepeatNote=4
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016440_448301590RepeatNote=5
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016449_457301590RepeatNote=6
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016458_465301590RepeatNote=7
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016466_473301590RepeatNote=8
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016474_481301590RepeatNote=9
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016482_488301590RepeatNote=10
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016489_496301590RepeatNote=11
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016497_503301590RepeatNote=12
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016504_510301590RepeatNote=13
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016511_517301590RepeatNote=14
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016518_524301590RepeatNote=15
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016525_533301590RepeatNote=16
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016534_543301590RepeatNote=17
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016544_551301590RepeatNote=18
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016552_560301590RepeatNote=19
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016561_568301590RepeatNote=20
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016569_575301590RepeatNote=21
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016407_413304593RepeatNote=1
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016414_420304593RepeatNote=2
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016421_429304593RepeatNote=3
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016430_439304593RepeatNote=4
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016440_448304593RepeatNote=5
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016449_457304593RepeatNote=6
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016458_465304593RepeatNote=7
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016466_473304593RepeatNote=8
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016474_481304593RepeatNote=9
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016482_488304593RepeatNote=10
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016489_496304593RepeatNote=11
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016497_503304593RepeatNote=12
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016504_510304593RepeatNote=13
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016511_517304593RepeatNote=14
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016518_524304593RepeatNote=15
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016525_533304593RepeatNote=16
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016534_543304593RepeatNote=17
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016544_551304593RepeatNote=18
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016552_560304593RepeatNote=19
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016561_568304593RepeatNote=20
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016569_575304593RepeatNote=21
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016354_385301590Zinc fingerRanBP2-type
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016354_385304593Zinc fingerRanBP2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDK12chr17:37682569chr17:34169371ENST00000430627+13141266_128012531482Compositional biasNote=Poly-Pro
HgeneCDK12chr17:37682569chr17:34169371ENST00000447079+13141266_128012531491Compositional biasNote=Poly-Pro
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+10161_208301590Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+10161_208304593Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr17:37682569chr17:34169371ENST00000311979+1016234_320301590DomainRRM
TgeneTAF15chr17:37682569chr17:34169371ENST00000588240+1016234_320304593DomainRRM


Top

FusionGeneSequence for CDK12_TAF15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_1542aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRG
GGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRN

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_1490aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRTGGAMEETVVVAVATVETEVEAMEETGVVAAMEETEVGATEETEVAMEAKWEEETTTEMISATDHTDDC

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_1542aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRG
GGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRN

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_1542aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRG
GGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRN

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_1490aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRTGGAMEETVVVAVATVETEVEAMEETGVVAAMEETEVGATEETEVAMEAKWEEETTTEMISATDHTDDC

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_1542aa
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVETDDISSDSDTFSDDMAFK
LDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDTGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASTGQDTDLSPSRSHTSSNTDSYKKSPGSTS
RRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPTSRRRSSSYERSGSYSGRSPSPTGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
ATSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRS
VKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPTKKRPKICCPRTGERRQTESDWG
KRCVDKFDIIGIIGEGTTGQVTKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFY
LVFETMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLTNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQTRRRLREEFSFIP
SAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDS
ETMAPEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAGKEFHGN
IIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
ERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRG
GGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGTGGDRGGGYGGDRGGTGGKMGGRN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_4626nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGA
AGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGC
GGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGT
GGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGC
TATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGA
GACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAAC

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_4470nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTG
GTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCT
ACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGT
TTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTG

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_4626nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGA
AGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGC
GGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGT
GGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGC
TATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGA
GACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAAC

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_4626nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGA
AGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGC
GGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGT
GGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGC
TATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGA
GACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAAC

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_4470nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTG
GTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCT
ACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGT
TTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTG

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_4626nt
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCT
AACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAA
CTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGT
TCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTAC
AAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCG
AGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGG
CGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCA
CTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGT
GTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAG
GAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAG
CCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTG
CCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCA
ATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGA
GAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTAC
CTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGT
GGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTC
ACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCT
TCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAG
CGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAG
CTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCA
GAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAAC
AACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAAC
ATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGA
GGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCT
CGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGA
GAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGA
AGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGC
GGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGT
GGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGC
TATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGA
GACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_5234nt
CCCGGCGCCCGGGCCTGAGGACTGGCTCGGCGGAGGGAGAAGAGGAAACAGACTTGAGCAGCTCCCCGTTGTCTCGCAACTCCACTGCCG
AGGAACTCTCATTTCTTCCCTCGCTCCTTCACCCCCCACCTCATGTAGAAGGGTGCTGAGGCGTCGGGAGGGAGGAGGAGCCTGGGCTAC
CGTCCCTGCCCTCCCCACCCCCTTCCCGGGGCGCTTTGGTGGGCGTGGAGTTGGGGTTGGGGGGGTGGGTGGGGGTTGCTTTTTGGAGTG
CTGGGGAACTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAG
CTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGT
CCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCA
GCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACC
GCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCT
CCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAG
CCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACC
GGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGT
GGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGA
GCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGT
CCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTG
GCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCAC
TCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTT
CACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAG
CAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGG
CTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACAC
ATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAG
CACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTC
CACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAA
TACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTT
CTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAG
CTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAG
AAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTG
GTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTC
CTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAA
CCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCT
TCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAAC
AAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTG
GTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGC
ATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTG
AAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCA
TAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAAC
TGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGC
AATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTA
AGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGC
AGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTC
GAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTG
GGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAA
CCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCA
TCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAG
TGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGC
TGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAA
TGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAG
GTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATT
GGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTC
GTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCT
ATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTG
GAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTG
GCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTT
ACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTG
GCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAG
GAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAA
TGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTA
AGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAAC
CTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTGTTTT

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_4913nt
CCCGGCGCCCGGGCCTGAGGACTGGCTCGGCGGAGGGAGAAGAGGAAACAGACTTGAGCAGCTCCCCGTTGTCTCGCAACTCCACTGCCG
AGGAACTCTCATTTCTTCCCTCGCTCCTTCACCCCCCACCTCATGTAGAAGGGTGCTGAGGCGTCGGGAGGGAGGAGGAGCCTGGGCTAC
CGTCCCTGCCCTCCCCACCCCCTTCCCGGGGCGCTTTGGTGGGCGTGGAGTTGGGGTTGGGGGGGTGGGTGGGGGTTGCTTTTTGGAGTG
CTGGGGAACTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAG
CTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGT
CCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCA
GCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACC
GCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCT
CCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAG
CCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACC
GGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGT
GGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGA
GCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGT
CCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTG
GCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCAC
TCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTT
CACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAG
CAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGG
CTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACAC
ATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAG
CACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTC
CACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAA
TACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTT
CTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAG
CTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAG
AAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTG
GTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTC
CTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAA
CCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCT
TCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAAC
AAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTG
GTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGC
ATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTG
AAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCA
TAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAAC
TGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGC
AATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTA
AGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGC
AGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTC
GAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTG
GGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAA
CCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCA
TCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAG
TGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGC
TGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAA
TGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAG
GTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATT
GGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTC
GTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCT
ATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGA
CAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGA
CTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAG
TTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGT
TTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGC

>In-frame_CDK12_ENST00000430627_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_5226nt
CCCGGCGCCCGGGCCTGAGGACTGGCTCGGCGGAGGGAGAAGAGGAAACAGACTTGAGCAGCTCCCCGTTGTCTCGCAACTCCACTGCCG
AGGAACTCTCATTTCTTCCCTCGCTCCTTCACCCCCCACCTCATGTAGAAGGGTGCTGAGGCGTCGGGAGGGAGGAGGAGCCTGGGCTAC
CGTCCCTGCCCTCCCCACCCCCTTCCCGGGGCGCTTTGGTGGGCGTGGAGTTGGGGTTGGGGGGGTGGGTGGGGGTTGCTTTTTGGAGTG
CTGGGGAACTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAG
CTTCTGGAACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGT
CCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCA
GCTCTGATTCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACC
GCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCT
CCAGCAAGTCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAG
CCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACC
GGAGTAAAAGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGT
GGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGA
GCAATTATGACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGT
CCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTG
GCTCTTACAGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCAC
TCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTT
CACGCAGTCGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAG
CAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGG
CTAAGGATTCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACAC
ATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAG
CACAGGGAACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTC
CACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAA
TACCAGCTCTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTT
CTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAG
CTGCTATTCCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAG
AAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTG
GTGGAGATCTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTC
CTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAA
CCTATGGCCAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCT
TCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAAC
AAGATGCACTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTG
GTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGC
ATCGGGATATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTG
AAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCA
TAGATGTTTGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAAC
TGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGC
AATATCGAAGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTA
AGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGC
AGGATTGCCATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTC
GAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTG
GGGCTGGGGATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAA
CCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCA
TCAGTGCCCTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAG
TGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGC
TGATGAAAACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAA
TGCCACAGGAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAG
GTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATT
GGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTC
GTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCT
ATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTG
GAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTG
GCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTT
ACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTG
GCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAG
GAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAA
TGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTA
AGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAAC
CTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTGTTTT

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000588240_chr17_34169371_+_4956nt
CTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGA
ACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACAC
TCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGAT
TCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCAC
AAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAG
TCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGC
AGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAA
AGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGAC
AGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTAT
GACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACC
CGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTAC
AGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGT
AGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGT
CGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCT
GCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGAT
TCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAAC
ACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGA
ACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTT
CCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCT
CTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCAC
TCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATT
CCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTT
CCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGAT
CTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTAT
GGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGC
CAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATC
ACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCA
CTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTG
CACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGAT
ATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGT
CGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTT
TGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGC
CGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGA
AGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGC
ACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGC
CATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAA
ACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGG
GATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTG
AGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCC
CTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTG
CCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAA
ACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAG
GAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGT
GGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGC
CCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCA
GGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGA
GACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGA
AGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGA
GGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGA
GATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGC
TACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGA
GGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTT
TGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACAT
TTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCC
CAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTGTTTTTGTGGACT

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000592237_chr17_34169371_+_4635nt
CTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGA
ACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACAC
TCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGAT
TCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCAC
AAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAG
TCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGC
AGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAA
AGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGAC
AGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTAT
GACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACC
CGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTAC
AGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGT
AGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGT
CGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCT
GCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGAT
TCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAAC
ACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGA
ACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTT
CCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCT
CTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCAC
TCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATT
CCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTT
CCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGAT
CTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTAT
GGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGC
CAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATC
ACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCA
CTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTG
CACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGAT
ATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGT
CGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTT
TGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGC
CGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGA
AGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGC
ACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGC
CATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAA
ACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGG
GATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTG
AGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCC
CTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTG
CCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAA
ACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAG
GAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGT
GGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGC
CCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCA
GGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGA
GACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTG
GTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAA
ATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCT
GCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTC
TAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGA

>In-frame_CDK12_ENST00000447079_chr17_37682569_+_TAF15_ENST00000311979_chr17_34169371_+_4948nt
CTTTTTTCCCTTCTTCAGGTCAGGGGAAAGGGAATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGA
ACTTTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCGAAGCACAAGCGGCATAAGTCCAAACAC
TCCAAAGACATGGGGTTGGTGACCCCCGAAGCAGCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGAT
TCCGACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGTGGATCAGATCGGAGCGACCGCCTGCAC
AAACATCGTCACCACCAGCACAGGCGTTCCCGGGACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAG
TCGGGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGACTATGGGAAGGCGCAGGTAGCCAAAAGC
AGCAGCAAGGAATCCAGGTCATCCAAGCTCCACAAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAA
AGTCATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCCAGGAGCCCCCACAGGAAGTGGTCTGAC
AGCTCCAAACAAGATGATAGCCCCTCGGGAGCTTCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTAT
GACTCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAGGAGCCTTCGGCCTACCAGTCCAGCACC
CGGTCACCGAGCCCCTACAGTAGGCGACAGAGATCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTAC
AGCGGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGGTCTCTGAGTCGGAGTCCACTCCCCAGT
AGGAAATCCATGAAGTCCAGAAGTAGAAGTCCTGCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGT
CGTCATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGTAGGAAAAAGAAGGAAAGAGCAGCTGCT
GCTGCTGCAGCAAAGATGGATGGAAAGGAGTCCAAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGAT
TCAGGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACTGAACTGGTGAATGTAACACATCTAAAC
ACAGAGGTAAAAAATTCTTCAGATACAGGGAAAGTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGA
ACAAGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACATCAGAAAAGGAGACCCCTCCACCTCTT
CCCACAATTGCTTCTCCCCCACCCCCTCTACCAACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCT
CTTCCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGTACTTCAACTTTGCCCCCTTCTACTCAC
TCAAAGACATCTGCTGTGTCCTCTCAGGCAAATTCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATT
CCACACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGATGACATGGATAGTCCAAAAGAAACTCTT
CCTTCAAAACCTGTGAAGAAAGAGAAGGAACAGAGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGAT
CTGTCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAGAGACCAAAAATTTGTTGTCCTCGTTAT
GGAGAAAGAAGACAAACAGAAAGCGACTGGGGGAAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGC
CAAGTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTAGACAATGAGAAAGAGGGCTTCCCAATC
ACAGCCATTCGTGAAATCAAAATCCTTCGTCAGTTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCA
CTGGATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTAATGGGACTGCTAGAATCTGGTTTGGTG
CACTTTTCTGAGGACCATATCAAGTCGTTCATGAAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGAT
ATTAAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTTGCTCGGCTCTATAACTCTGAAGAGAGT
CGCCCTTACACAAACAAAGTCATTACTTTGTGGTACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTT
TGGAGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTGGAACTGGCTCAGCTAGAACTGATCAGC
CGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGGCCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGA
AGGCGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATGCTGACACTAGATCCTAGTAAGCGGTGC
ACAGCTGAACAGACCCTACAGAGCGACTTCCTTAAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGC
CATGAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCACCTCCATCCAAAACTTCTCGAAAAGAA
ACTACCTCAGGGACAAGTACTGAGCCTGTGAAGAACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGG
GATGCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTAAACCTGCTGCAGAGCCAAACCGACCTG
AGCATCCCTCAAATGGCACAGCTGCTTAACATCCACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCC
CTGACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAGGAAGCACCCTCTGCCCCAGTGATCCTG
CCTTCAGCAGAACAGACGACCCTTGAAGCTTCAAGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAA
ACCCAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGGCCCCGAAGAACTCCCACAATGCCACAG
GAGGAGGCAGCAGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGT
GGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGC
CCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCA
GGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGA
GACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGA
AGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGA
GGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGA
GATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGC
TACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGA
GGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTT
TGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACAT
TTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCC


Top

FusionGenePPI for CDK12_TAF15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDK12MGMT, SRRM2, RBM39, ELAVL1, MYC, PRPF4, CDK13, CCNK, TRIM24, IPPK, VPS51, ZNF606, TCEB3, BARD1, PAXIP1, PRPF40A, EWSR1, CDK20, CDK9, PIN1, RPL14, ACAA1, MAP4K4, SCAF4, SUPT16H, SRPK2, CLK1, BCLAF1, RNPS1, SNW1, PCGF1, CDX1, RPL37A, RRS1, ZNF2, FGF8, RPS14, WEE1, LASP1TAF15SAFB, PRMT1, TAF7, TAF5, TAF13, TAF11, POLR2C, POLR2G, POLR2E, SF1, KAT2B, POLR2A, HIST2H2AC, HIST1H3A, HIST2H4A, CACNA1A, SIRT7, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDB1, TPR, SAP30BP, RNF168, SCARB2, TPM2, TMED9, MED26, PRMT8, FUS, RPA3, RPA2, RPA1, HIST3H3, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, RPS6KB2, ACAA2, SFN, HNRNPA1, PPP1CB, MATR3, MED12, MCM2, NF2, DNPEP, KLHL8, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDK12_TAF15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDK12_TAF15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTAF15C0029463Osteosarcoma1CTD_human
TgeneTAF15C0038356Stomach Neoplasms1CTD_human