FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6341

FusionGeneSummary for CDC37_ELL

check button Fusion gene summary
Fusion gene informationFusion gene name: CDC37_ELL
Fusion gene ID: 6341
HgeneTgene
Gene symbol

CDC37

ELL

Gene ID

11140

8178

Gene namecell division cycle 37elongation factor for RNA polymerase II
SynonymsP50CDC37C19orf17|ELL1|MEN|PPP1R68
Cytomap

19p13.2

19p13.11

Type of geneprotein-codingprotein-coding
Descriptionhsp90 co-chaperone Cdc37CDC37 (cell division cycle 37, S. cerevisiae, homolog)CDC37 cell division cycle 37 homologcell division cycle 37 homologhsp90 chaperone protein kinase-targeting subunitRNA polymerase II elongation factor ELLELL gene (11-19 lysine-rich leukemia gene)eleven-nineteen lysine-rich leukemia proteinelongation factor RNA polymerase IIprotein phosphatase 1, regulatory subunit 68
Modification date2018052320180519
UniProtAcc

Q16543

P55199

Ensembl transtripts involved in fusion geneENST00000222005, ENST00000262809, 
ENST00000596124, 
Fusion gene scores* DoF score5 X 4 X 3=606 X 10 X 5=300
# samples 614
** MAII scorelog2(6/60*10)=0log2(14/300*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDC37 [Title/Abstract] AND ELL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneELL

GO:0010923

negative regulation of phosphatase activity

19389623


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-05-4426-01ACDC37chr19

10514054

-ELLchr19

18583692

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000222005ENST00000262809CDC37chr19

10514054

-ELLchr19

18583692

-
5CDS-5UTRENST00000222005ENST00000596124CDC37chr19

10514054

-ELLchr19

18583692

-

Top

FusionProtFeatures for CDC37_ELL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDC37

Q16543

ELL

P55199

Co-chaperone that binds to numerous kinases and promotestheir interaction with the Hsp90 complex, resulting instabilization and promotion of their activity (PubMed:8666233).Inhibits HSP90AA1 ATPase activity (PubMed:23569206).{ECO:0000269|PubMed:23569206, ECO:0000269|PubMed:8666233}. Elongation factor component of the super elongationcomplex (SEC), a complex required to increase the catalytic rateof RNA polymerase II transcription by suppressing transientpausing by the polymerase at multiple sites along the DNA.Elongation factor component of the little elongation complex(LEC), a complex required to regulate small nuclear RNA (snRNA)gene transcription by RNA polymerase II and III (PubMed:22195968,PubMed:23932780). Specifically required for stimulating theelongation step of RNA polymerase II- and III-dependent snRNA genetranscription (PubMed:23932780). ELL also plays an early rolebefore its assembly into in the SEC complex by stabilizing RNApolymerase II recruitment/initiation and entry into the pausesite. Required to stabilize the pre-initiation complex and earlyelongation. {ECO:0000269|PubMed:16006523,ECO:0000269|PubMed:20159561, ECO:0000269|PubMed:20471948,ECO:0000269|PubMed:22195968, ECO:0000269|PubMed:22252557,ECO:0000269|PubMed:23932780, ECO:0000269|PubMed:8596958}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneELLchr19:10514054chr19:18583692ENST00000262809-012445_45945622MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CDC37_ELL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDC37_ENST00000222005_chr19_10514054_-_ELL_ENST00000262809_chr19_18583692_-_611aa
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQDSVSLRPSIRFQGSQGHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQTVS
SHGEVHLDCLGSIQDKITVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKS
GASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQ
QLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGP
PASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERA
AEDKPRAQLPDCAPATHATPGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDC37_ENST00000222005_chr19_10514054_-_ELL_ENST00000262809_chr19_18583692_-_1833nt
ATGGTGGACTACAGCGTGTGGGACCACATTGAGGTGTCTGATGATGAAGACGAGACGCACCCCAACATCGACACGGCCAGTCTCTTCCGC
TGGCGGCATCAGGATTCTGTTTCACTGAGGCCATCTATCCGATTTCAAGGAAGCCAAGGGCACATCTCCATCCCCCAGCCTGACTGCCCC
GCAGAGGCGCGGACGTTCTCCTTCTACCTCTCCAACATCGGCCGCGACAACCCCCAGGGCAGCTTCGACTGCATCCAGCAGTATGTCTCC
AGTCATGGGGAAGTTCACCTGGACTGCCTGGGCAGCATACAGGACAAGATCACGGTGTGTGCCACCGACGACTCCTACCAGAAGGCGCGG
CAGAGCATGGCCCAGGCGGAGGAGGAGACGCGGAGCCGAAGTGCCATTGTCATCAAGGCTGGAGGCCGCTACCTGGGCAAGAAGGTTCAG
TTTCGGAAACCAGCCCCAGGTGCAACAGACGCGGTGCCCTCCCGGAAGCGGGCAACCCCCATCAACTTGGCGAGTGCCATCAGGAAGAGT
GGTGCCAGTGCCGTGAGTGGGGGCAGCGGGGTGTCCCAGAGGCCCTTCCGTGACCGAGTGCTGCACCTCCTGGCACTACGGCCCTACCGC
AAGGCTGAGCTGCTGCTGCGACTGCAGAAGGACGGCCTGACGCAGGCGGACAAGGACGCGCTGGATGGCCTCCTCCAGCAGGTGGCCAAC
ATGAGTGCTAAGGACGGCACGTGTACACTGCAGGACTGCATGTACAAGGATGTGCAGAAGGACTGGCCTGGCTACTCGGAGGGGGACCAG
CAGCTGCTGAAGCGGGTGCTCGTCCGGAAGCTGTGCCAGCCACAGAGCACTGGCAGCCTCCTTGGAGACCCTGCTGCCTCCAGCCCCCCA
GGCGAGCGTGGGCGCTCGGCCTCGCCCCCACAGAAGCGGCTGCAGCCTCCTGATTTCATCGACCCCCTAGCCAACAAGAAACCCCGGATA
TCGCACTTCACTCAGAGAGCTCAGCCTGCCGTCAACGGGAAGCTGGGCGTGCCCAATGGCCGTGAGGCCTTGCTGCCCACCCCGGGCCCA
CCAGCCAGCACGGACACCCTCAGCTCCAGCACTCACCTGCCCCCGCGGCTGGAGCCCCCGAGGGCCCACGACCCCCTGGCCGATGTCAGC
AATGACCTGGGCCACAGCGGCCGAGACTGTGAGCACGGAGAGGCGGCTGCCCCAGCCCCCACTGTGCGCCTCGGCCTGCCCCTGCTGACG
GACTGTGCCCAGCCCAGCAGGCCACACGGCAGCCCCTCGCGCAGCAAGCCCAAGAAGAAGTCCAAGAAGCACAAAGACAAGGAGAGGGCG
GCTGAGGACAAGCCCCGGGCCCAGCTTCCAGACTGTGCACCTGCCACCCATGCCACCCCCGGAGCCCCAGCAGACACCCCAGGTTTAAAC
GGAACCTGCAGCGTTTCCAGTGTTCCCACGTCCACGTCGGAGACGCCTGACTACTTGCTGAAGTACGCAGCCATCTCCTCTTCGGAGCAG
CGCCAGAGCTACAAGAACGACTTCAATGCCGAGTACAGCGAGTACCGCGACCTGCACGCCCGCATTGAGCGCATCACGCGGCGGTTCACC
CAGCTCGACGCCCAGCTCCGGCAGCTCTCCCAGGGCTCCGAGGAGTATGAGACTACTCGAGGGCAGATTTTGCAGGAATATCGAAAAATC
AAAAAGACCAACACCAACTACAGCCAGGAGAAGCACCGCTGCGAGTACCTGCACAGCAAGCTGGCCCACATCAAGAGGCTCATCGCCGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDC37_ENST00000222005_chr19_10514054_-_ELL_ENST00000262809_chr19_18583692_-_3976nt
TGCTGCCGCCGTCGCCGCCACCCGAGCCGGAGCGGGCTGGGCCGCCAAGGCAAGATGGTGGACTACAGCGTGTGGGACCACATTGAGGTG
TCTGATGATGAAGACGAGACGCACCCCAACATCGACACGGCCAGTCTCTTCCGCTGGCGGCATCAGGATTCTGTTTCACTGAGGCCATCT
ATCCGATTTCAAGGAAGCCAAGGGCACATCTCCATCCCCCAGCCTGACTGCCCCGCAGAGGCGCGGACGTTCTCCTTCTACCTCTCCAAC
ATCGGCCGCGACAACCCCCAGGGCAGCTTCGACTGCATCCAGCAGTATGTCTCCAGTCATGGGGAAGTTCACCTGGACTGCCTGGGCAGC
ATACAGGACAAGATCACGGTGTGTGCCACCGACGACTCCTACCAGAAGGCGCGGCAGAGCATGGCCCAGGCGGAGGAGGAGACGCGGAGC
CGAAGTGCCATTGTCATCAAGGCTGGAGGCCGCTACCTGGGCAAGAAGGTTCAGTTTCGGAAACCAGCCCCAGGTGCAACAGACGCGGTG
CCCTCCCGGAAGCGGGCAACCCCCATCAACTTGGCGAGTGCCATCAGGAAGAGTGGTGCCAGTGCCGTGAGTGGGGGCAGCGGGGTGTCC
CAGAGGCCCTTCCGTGACCGAGTGCTGCACCTCCTGGCACTACGGCCCTACCGCAAGGCTGAGCTGCTGCTGCGACTGCAGAAGGACGGC
CTGACGCAGGCGGACAAGGACGCGCTGGATGGCCTCCTCCAGCAGGTGGCCAACATGAGTGCTAAGGACGGCACGTGTACACTGCAGGAC
TGCATGTACAAGGATGTGCAGAAGGACTGGCCTGGCTACTCGGAGGGGGACCAGCAGCTGCTGAAGCGGGTGCTCGTCCGGAAGCTGTGC
CAGCCACAGAGCACTGGCAGCCTCCTTGGAGACCCTGCTGCCTCCAGCCCCCCAGGCGAGCGTGGGCGCTCGGCCTCGCCCCCACAGAAG
CGGCTGCAGCCTCCTGATTTCATCGACCCCCTAGCCAACAAGAAACCCCGGATATCGCACTTCACTCAGAGAGCTCAGCCTGCCGTCAAC
GGGAAGCTGGGCGTGCCCAATGGCCGTGAGGCCTTGCTGCCCACCCCGGGCCCACCAGCCAGCACGGACACCCTCAGCTCCAGCACTCAC
CTGCCCCCGCGGCTGGAGCCCCCGAGGGCCCACGACCCCCTGGCCGATGTCAGCAATGACCTGGGCCACAGCGGCCGAGACTGTGAGCAC
GGAGAGGCGGCTGCCCCAGCCCCCACTGTGCGCCTCGGCCTGCCCCTGCTGACGGACTGTGCCCAGCCCAGCAGGCCACACGGCAGCCCC
TCGCGCAGCAAGCCCAAGAAGAAGTCCAAGAAGCACAAAGACAAGGAGAGGGCGGCTGAGGACAAGCCCCGGGCCCAGCTTCCAGACTGT
GCACCTGCCACCCATGCCACCCCCGGAGCCCCAGCAGACACCCCAGGTTTAAACGGAACCTGCAGCGTTTCCAGTGTTCCCACGTCCACG
TCGGAGACGCCTGACTACTTGCTGAAGTACGCAGCCATCTCCTCTTCGGAGCAGCGCCAGAGCTACAAGAACGACTTCAATGCCGAGTAC
AGCGAGTACCGCGACCTGCACGCCCGCATTGAGCGCATCACGCGGCGGTTCACCCAGCTCGACGCCCAGCTCCGGCAGCTCTCCCAGGGC
TCCGAGGAGTATGAGACTACTCGAGGGCAGATTTTGCAGGAATATCGAAAAATCAAAAAGACCAACACCAACTACAGCCAGGAGAAGCAC
CGCTGCGAGTACCTGCACAGCAAGCTGGCCCACATCAAGAGGCTCATCGCCGAGTACGACCAGCGGCAGCTGCAGGCTTGGCCCTAGCCG
CCCTCCCCGATGGCGGGGATCTGGGAGGGTCGGGGGAGCAAAAGGCGGTGAGAGAGGATTTATTTAAAAAAATAAACCCGAGGAAGATGC
TCATCTGAGCCAGCACCGCCGGCTTTCAGGGCAGCCCCTGCAGACGTCTGGCCCTGGCGGGTGGCTGCAAGCCCACCTCGGCCCTCCCTG
CGCTTCCTGAGCAGTCCCTGCTTATGATGGGCTCCCCAGGAAGCCCACTGCCTCCTCCCTGGCTGCAGCCTCCGGGGTTCAGCCTCCTGT
CTCGCCAGAAGACTCCTAGGCCCTTGGGGTGGCGCGCCTGCCTTTTCTAGTTTTATACAAAGACAGCCACTTTTAGCTACTGCTAATGAG
ACTTGAGTCTATTTTTGTACAAAAGAGAAGCAAAATCTTTTTTCTAAACCTGTGCCTCCCTCTCCTCGGACACCCAGGGTCTAGCCGCTG
CCCTGGGTCCTGCCTGCAGTATTACAGAGGTCGTCGAAAGGTGCAGCTGCGTTCTGAGGGCGTGGGGAATGGGCAGGTGGCCTCTGCTGG
TCTCTGGCTCTACGTTTAGGCACCCCTTTCCCCAGCCTCTCCTCCTTGGGCAGGGTCTCTGCTCCAGCAAGCAAACAGGGTGGCCCAGGT
GGCTATTTTGAGAACTCCAGCTGGTGCCCCCAGACAGCTGCTCAGAGCCAAGGGGGCAGAGGGCTTTCAGCGCCCCCAGGCCTGCCCTGC
TATTTCAGGCCCTCAGCTGTCGGGGGCCACTGTGTTTCTGTGCTCCAAGTTGAGACTCGGCCGCAGCGGCGTCAGACTTTTCTTTGCGAT
GTCCTCGGTTTCCCATTTGTTGCTGCTGCTGCTCATTCCACACTGTTGAGACCTTGTGGTCTCGATGCTGCTGGCCTCCCTCCGTCCCTC
TGTCCACTTGTGGGTCCTGGGGTCGTCTTAGCAGAGCCACCGCCAAGGTTTGCACTCAGGGAGGGGCTGATGGAGGGCTGGGCGCCATGG
GGTCAGGGAGGCCCCAGGGACCCATGGGCAGAGCTGGGGAGCCAGGAGGATGGGTCTGCCTGCTCTGGGGGTGCAGGCTCTGCAGACACC
CCAATTGCTGCTCTGTTGCTGTGCCTAGTCTAGTGTCCCCCAAAGCATCGGGGGGCCACGCAAGTGTGGGTGTGTGAGTGTGCGTATGTG
GGGACCCCCCAGGGCATGGTGGGGTCTGAGGCGTGTGTTCCCATTTAGGGCTGAATGAAGCCATGACTTGGAAAGGTGGTGGGGGGTGGA
TGGCGGCTGTGACTCAGGGCCCAGGGATCACATGGGGGTCACTGCTGCCATCAGCAGTCAGGCAGGGAGAACAGAAATGCAAAAATACAG
ATGTCTATTTTTCTAAACTGGGGGGTGGAGGGGTGCCTCCTGACAGCTTCCAAAGAGCTGACTGTGGAGGGCCCACAGTGTATCCCACCC
CTGCCCGAGAGTCTCTCTCCTTTGGGACCCCCGGGTTCCCAGAGCTCCGAGGAAACTGATCCTTCATGTTTCAATAGCTGTTGTTGTTTT
TCTCTTTGGGCCGGGCCGGGCCGGGGAAGGGCCGAGCAGGCTCCAGGAGGCCTCCAGAGTCAGCTGGACCTTGCTGTGTCGCCCGCAGGC
AGCCCTGCAGACACCGGTGAGGTGGGATGATTTCAGGAGGTCCCAGCCCGGGACTGCCCGCCCCTCTGCCCTGGGAACCAGTCCAAGGGG
CTGTCAGTTGAATTTGCCTTTTTGTTGTTGTTGTTGTTTTTGTTGTTTATTTGTTCTCCTTTTAAGGAATTATGAAGCTAAGAAAAGTTT
TGTGTTTTGGGGGTTGGTGGACAAAGTTCTAGCTGATTAAATATGGTCTAACTTATTGATACTATTTTTTTTTCTTTTAATGTTGTACTG
TGGAGAAAAACTATTTTGAGCCATGGGGTTGGTGTTTACAAGAACTTTCCACTTTTGCCAAAATGTTACAATTGAAAGGCATCTATCTGC
GTCTTCAGTTTCCTGATATTTTCTTAAAAGATCTAGTGTCCTTTTTGTACACTAAACAGGTGAATGCTGACTTTTTTCATTCTCCAATAA


Top

FusionGenePPI for CDC37_ELL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDC37CDK4, SGK1, SMYD2, NEK6, MAP3K1, MAP3K3, TBK1, IKBKG, IKBKE, HSP90AA1, IKBKB, CHUK, AR, SRC, CDK7, CDK6, DMWD, ATG101, STK11, ULK1, CDK11B, AKT1, EMD, TERF1, TERF2, FGFR3, RYK, PRKAA1, PRKCI, MAP3K7, IRAK2, RIPK3, C19orf44, DEAF1, IMMT, CRYM, ZNF667, MTOR, PRMT1, CC2D1A, PPHLN1, PSME1, SPTBN4, ZNF205, CHGA, ZNF266, RPS15A, SQSTM1, SAFB, GCH1, BTBD10, NCOA5, MZT2B, LUC7L2, SNX5, DCTN1, ZNF235, EIF2AK1, NTRK1, CDK9, CDC37, UBE2I, PINK1, STK36, IRAK1, LRRK2, LRRK1, STK33, GRK5, NOS3, APOE, APP, CDK5, DNAJB1, ECSIT, ELAVL3, EXOSC1, FBXL12, GCDH, IFIT3, IFIT5, LONP1, LOXL4, MGEA5, PRAM1, PRDX2, RAD23A, RNF32, FBXW4, CYP2C9, STAMBPL1, PSEN1, A2M, RPS6KA6, EGFR, YWHAE, VCP, BRAF, PPP5C, MAP3K11, NPM1, HSP90AB1, MAPK7, FBXO6, CKS2, CKS1B, OGFR, PPP6R3, TPM1, USP7, RHOBTB2, AIP, RAF1, AURKB, FKBP5, FKBP4, USP19, AHSA1, SMYD3, CTTN, UPF1, STUB1, SKP1, UNC45A, CHORDC1, TTC4, TOMM34, RAE1, SYNE2, PPID, TTC9C, ARAF, CDK1, CDK11A, NUP98, FKBPL, FER, GLMN, DDX17, RPAP3, ABL2, TARS2, DNAJC7, HNRNPM, CDC37L1, FKBP6, PDZK1, AURKA, CDC25C, MOV10, NXF1, ULK3, RSG1, PSKH2, MYLK4, STK32C, PCBP1, CDKL1, CDKL2, AURKC, CDK15, CDK18, CDK13, STK4, RASSF3, STK38L, RPS6KB2, AHCYL1, PATL1, SSB, EWSR1, OFD1, CEP104, EVC2, NEK8, POC1B, STIL, PRPF4, FTSJ1, CDCA5, WDR6, PANX1, ERBB3, ESRRB, YWHAQ, SLC25A5, SLC25A6, CLK3, DDR1, DDX5, EIF2AK2, EEF1A1, EEF1A2, EEF1A1P5, EIF3B, ERBB2, GFAP, HSPA5, HSPA1A, HSPA8, PKM, RPS6KA1, RPS6KA3, RPS6KA4, MASP1, RPS2, RPS27, RPS27L, TUBA1B, TUBA1C, TUBB, U2AF2, EIF2S1, HCK, PTGES3, FLCN, FNIP1, FNIP2, STK35, AKT3, PDIK1L, BTK, YES1, ITK, MAP3K6, FYN, TNK2, MAP2K5, CYLD, DLD, DNM1L, EDEM3, SNRPE, BRCA1ELLSIRT2, ZHX1, TP53, EAF1, EAF2, SNF8, USPL1, MLLT3, MLLT1, KMT2A, TFPT, UBC, MED26, ICE2, ICE1, AFF4, CDK9, MCM2, SNRPA1, ELL3, DENND2D, OFD1, DYNLL1, CTR9, HUWE1, NCBP2, FGFR1OP2, SIKE1, VWA9, ASPM, CAMKV, PIP4K2A, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDC37_ELL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDC37_ELL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource