FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6337

FusionGeneSummary for CDC27_USP32

check button Fusion gene summary
Fusion gene informationFusion gene name: CDC27_USP32
Fusion gene ID: 6337
HgeneTgene
Gene symbol

CDC27

USP32

Gene ID

996

84669

Gene namecell division cycle 27ubiquitin specific peptidase 32
SynonymsANAPC3|APC3|CDC27Hs|D0S1430E|D17S978E|H-NUC|HNUC|NUC2NY-REN-60|USP10
Cytomap

17q21.32

17q23.1-q23.2

Type of geneprotein-codingprotein-coding
Descriptioncell division cycle protein 27 homologD0S1430E, D17S978Eanaphase promoting complex subunit 3anaphase-promoting complex, protein 3cell division cycle 27 homolognuc2 homologubiquitin carboxyl-terminal hydrolase 32deubiquitinating enzyme 32renal carcinoma antigen NY-REN-60ubiquitin specific protease 32ubiquitin thioesterase 32ubiquitin thiolesterase 32ubiquitin-specific-processing protease 32
Modification date2018052320180523
UniProtAcc

P30260

Q8NFA0

Ensembl transtripts involved in fusion geneENST00000066544, ENST00000531206, 
ENST00000446365, ENST00000527547, 
ENST00000528748, 
ENST00000300896, 
ENST00000592339, ENST00000393003, 
ENST00000586881, 
Fusion gene scores* DoF score10 X 5 X 9=45012 X 7 X 6=504
# samples 1012
** MAII scorelog2(10/450*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/504*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDC27 [Title/Abstract] AND USP32 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDC27

GO:0070979

protein K11-linked ubiquitination

18485873


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A228-01ACDC27chr17

45234596

-USP32chr17

58379065

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000066544ENST00000300896CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000066544ENST00000592339CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000066544ENST00000393003CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-5UTRENST00000066544ENST00000586881CDC27chr17

45234596

-USP32chr17

58379065

-
In-frameENST00000531206ENST00000300896CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000531206ENST00000592339CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000531206ENST00000393003CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-5UTRENST00000531206ENST00000586881CDC27chr17

45234596

-USP32chr17

58379065

-
Frame-shitENST00000446365ENST00000300896CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000446365ENST00000592339CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000446365ENST00000393003CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-5UTRENST00000446365ENST00000586881CDC27chr17

45234596

-USP32chr17

58379065

-
In-frameENST00000527547ENST00000300896CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000527547ENST00000592339CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-intronENST00000527547ENST00000393003CDC27chr17

45234596

-USP32chr17

58379065

-
5CDS-5UTRENST00000527547ENST00000586881CDC27chr17

45234596

-USP32chr17

58379065

-
5UTR-3CDSENST00000528748ENST00000300896CDC27chr17

45234596

-USP32chr17

58379065

-
5UTR-intronENST00000528748ENST00000592339CDC27chr17

45234596

-USP32chr17

58379065

-
5UTR-intronENST00000528748ENST00000393003CDC27chr17

45234596

-USP32chr17

58379065

-
5UTR-5UTRENST00000528748ENST00000586881CDC27chr17

45234596

-USP32chr17

58379065

-

Top

FusionProtFeatures for CDC27_USP32


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDC27

P30260

USP32

Q8NFA0

Component of the anaphase promoting complex/cyclosome(APC/C), a cell cycle-regulated E3 ubiquitin ligase that controlsprogression through mitosis and the G1 phase of the cell cycle.The APC/C complex acts by mediating ubiquitination and subsequentdegradation of target proteins: it mainly mediates the formationof 'Lys-11'-linked polyubiquitin chains and, to a lower extent,the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitinchains. {ECO:0000269|PubMed:18485873}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619115_145210825RepeatNote=TPR 4
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-61938_65210825RepeatNote=TPR 2
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-61967_99210825RepeatNote=TPR 3
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-6196_35210825RepeatNote=TPR 1
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619115_145210831RepeatNote=TPR 4
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-61938_65210831RepeatNote=TPR 2
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-61967_99210831RepeatNote=TPR 3
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-6196_35210831RepeatNote=TPR 1
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134241_252621605Calcium binding1
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134277_288621605Calcium binding2
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134228_263621605DomainEF-hand 2
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134264_299621605DomainEF-hand 3
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134369_585621605DomainDUSP
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-134734_1567621605DomainNote=USP
TgeneUSP32chr17:45234596chr17:58379065ENST00000300896-13491_126621605DomainEF-hand 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619465_495210825RepeatNote=TPR 5
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619499_528210825RepeatNote=TPR 6
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619533_563210825RepeatNote=TPR 7
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619567_598210825RepeatNote=TPR 8
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619601_631210825RepeatNote=TPR 9
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619635_667210825RepeatNote=TPR 10
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619670_702210825RepeatNote=TPR 11
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619704_734210825RepeatNote=TPR 12
HgeneCDC27chr17:45234596chr17:58379065ENST00000066544-619737_768210825RepeatNote=TPR 13
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619465_495210831RepeatNote=TPR 5
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619499_528210831RepeatNote=TPR 6
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619533_563210831RepeatNote=TPR 7
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619567_598210831RepeatNote=TPR 8
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619601_631210831RepeatNote=TPR 9
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619635_667210831RepeatNote=TPR 10
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619670_702210831RepeatNote=TPR 11
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619704_734210831RepeatNote=TPR 12
HgeneCDC27chr17:45234596chr17:58379065ENST00000531206-619737_768210831RepeatNote=TPR 13


Top

FusionGeneSequence for CDC27_USP32


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDC27_ENST00000066544_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_1753aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQ
ILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGNYVIREEMERMLHV
VDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRT
GRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKD
NRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQA
GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAGSGFLYS
ATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYH
WYGANLALPRPVIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIK
EEDMRLWLYNSENYLTLLDDEDHKLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCV
SNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLN
RVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTT
PVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPVSPISASSPTQTDFSSSPSTNE
MFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVH
TRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPT
ALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRW
IKSQKIVKFPRESFDPSAFLVPRDPALCQHKPLTPQGDELSEPRILAREVKKVDAQSSAGEEDVLLSKSPSSLSANIISSPKGSPSSSRK
SGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGQICELADALSRGHVLGGSQPELVTPQDHEVALANGF
LYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAYIL

>In-frame_CDC27_ENST00000531206_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_1753aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQ
ILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGNYVIREEMERMLHV
VDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRT
GRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKD
NRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQA
GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAGSGFLYS
ATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYH
WYGANLALPRPVIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIK
EEDMRLWLYNSENYLTLLDDEDHKLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCV
SNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLN
RVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTT
PVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPVSPISASSPTQTDFSSSPSTNE
MFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVH
TRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPT
ALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRW
IKSQKIVKFPRESFDPSAFLVPRDPALCQHKPLTPQGDELSEPRILAREVKKVDAQSSAGEEDVLLSKSPSSLSANIISSPKGSPSSSRK
SGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGQICELADALSRGHVLGGSQPELVTPQDHEVALANGF
LYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAYIL

>In-frame_CDC27_ENST00000527547_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_1753aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQ
ILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGNYVIREEMERMLHV
VDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRT
GRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKD
NRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQA
GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAGSGFLYS
ATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYH
WYGANLALPRPVIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIK
EEDMRLWLYNSENYLTLLDDEDHKLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCV
SNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLN
RVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTT
PVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPVSPISASSPTQTDFSSSPSTNE
MFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVH
TRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPT
ALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRW
IKSQKIVKFPRESFDPSAFLVPRDPALCQHKPLTPQGDELSEPRILAREVKKVDAQSSAGEEDVLLSKSPSSLSANIISSPKGSPSSSRK
SGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGQICELADALSRGHVLGGSQPELVTPQDHEVALANGF
LYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAYIL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDC27_ENST00000066544_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5259nt
ATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGC
CTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTC
TTGAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGAACAA
ATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTCATTG
TTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTGGTCT
CCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTG
CCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATT
GTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAAAGAT
GAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCACGTG
GTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTTTCTA
AACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTAC
CAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCGGACT
GGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGATGAA
AATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATTTTGC
TTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAAGGAC
AACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGT
CATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATA
GTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCAAGCA
GGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCAACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGAGCCA
TCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAACTGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCTCAGT
TACGTGAATACTACAGAAGAGAAATTTTCAGACAACATTTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTATTCT
GCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACATAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAATATT
TTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGATAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAACACTA
GAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCATGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTATCAC
TGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTATCAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTATCTT
CTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCAGTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACCTTTA
AAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAATGCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCATTAAA
GAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAACTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAAAATC
CAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAAAATA
GATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTGTGTT
AGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGGGCAT
ATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTGGAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCATAGCA
AAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGACTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTTAAT
CGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAGTGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCATCTA
AGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGGGCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGTCCGA
TTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAATGGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTACTACC
CCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTCAGAA
CAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAAGAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATTTTTG
TGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTCAGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAATGAA
ATGTTCACCCTAACTACCAATGGGGACCTACCCCGACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAACTGAG
AAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCGAAAA
ATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGTGCAT
ACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCATGCC
CAGGATTGTGACGACAGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCCATGG
TATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCCCACA
GCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGTTGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGAGCCC
ATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGACCCAC
TGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCCACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCGGTGG
ATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAGTTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCAGCAT
AAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCCCAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGCTGGG
GAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACTCAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAGAAAA
AGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCTGCCC
CAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGAGAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCTGGCT
GACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCAACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGGATTC
CTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAGAGAA
GATACTCGTATTAAGCCTATTTATAATCTATATGCAATTTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGCCAAA
AACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAGCTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACATTCTT
TTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCTGCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGAAGAC

>In-frame_CDC27_ENST00000531206_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5259nt
ATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGC
CTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTC
TTGAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGAACAA
ATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTCATTG
TTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTGGTCT
CCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTG
CCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATT
GTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAAAGAT
GAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCACGTG
GTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTTTCTA
AACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTAC
CAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCGGACT
GGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGATGAA
AATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATTTTGC
TTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAAGGAC
AACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGT
CATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATA
GTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCAAGCA
GGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCAACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGAGCCA
TCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAACTGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCTCAGT
TACGTGAATACTACAGAAGAGAAATTTTCAGACAACATTTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTATTCT
GCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACATAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAATATT
TTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGATAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAACACTA
GAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCATGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTATCAC
TGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTATCAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTATCTT
CTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCAGTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACCTTTA
AAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAATGCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCATTAAA
GAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAACTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAAAATC
CAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAAAATA
GATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTGTGTT
AGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGGGCAT
ATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTGGAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCATAGCA
AAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGACTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTTAAT
CGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAGTGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCATCTA
AGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGGGCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGTCCGA
TTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAATGGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTACTACC
CCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTCAGAA
CAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAAGAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATTTTTG
TGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTCAGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAATGAA
ATGTTCACCCTAACTACCAATGGGGACCTACCCCGACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAACTGAG
AAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCGAAAA
ATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGTGCAT
ACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCATGCC
CAGGATTGTGACGACAGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCCATGG
TATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCCCACA
GCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGTTGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGAGCCC
ATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGACCCAC
TGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCCACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCGGTGG
ATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAGTTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCAGCAT
AAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCCCAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGCTGGG
GAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACTCAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAGAAAA
AGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCTGCCC
CAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGAGAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCTGGCT
GACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCAACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGGATTC
CTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAGAGAA
GATACTCGTATTAAGCCTATTTATAATCTATATGCAATTTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGCCAAA
AACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAGCTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACATTCTT
TTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCTGCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGAAGAC

>In-frame_CDC27_ENST00000527547_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5259nt
ATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGC
CTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTC
TTGAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGAACAA
ATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTCATTG
TTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTGGTCT
CCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTG
CCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATT
GTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAAAGAT
GAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCACGTG
GTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTTTCTA
AACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTAC
CAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCGGACT
GGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGATGAA
AATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATTTTGC
TTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAAGGAC
AACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGT
CATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATA
GTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCAAGCA
GGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCAACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGAGCCA
TCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAACTGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCTCAGT
TACGTGAATACTACAGAAGAGAAATTTTCAGACAACATTTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTATTCT
GCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACATAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAATATT
TTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGATAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAACACTA
GAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCATGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTATCAC
TGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTATCAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTATCTT
CTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCAGTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACCTTTA
AAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAATGCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCATTAAA
GAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAACTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAAAATC
CAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAAAATA
GATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTGTGTT
AGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGGGCAT
ATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTGGAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCATAGCA
AAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGACTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTTAAT
CGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAGTGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCATCTA
AGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGGGCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGTCCGA
TTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAATGGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTACTACC
CCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTCAGAA
CAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAAGAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATTTTTG
TGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTCAGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAATGAA
ATGTTCACCCTAACTACCAATGGGGACCTACCCCGACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAACTGAG
AAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCGAAAA
ATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGTGCAT
ACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCATGCC
CAGGATTGTGACGACAGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCCATGG
TATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCCCACA
GCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGTTGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGAGCCC
ATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGACCCAC
TGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCCACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCGGTGG
ATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAGTTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCAGCAT
AAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCCCAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGCTGGG
GAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACTCAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAGAAAA
AGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCTGCCC
CAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGAGAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCTGGCT
GACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCAACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGGATTC
CTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAGAGAA
GATACTCGTATTAAGCCTATTTATAATCTATATGCAATTTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGCCAAA
AACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAGCTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACATTCTT
TTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCTGCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGAAGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDC27_ENST00000066544_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5514nt
TCGCTGGTGAGTTTAAATGAGCAGGGGCTGGCCGGGCCGGAGCCGCTACAGGGGGGGCCTGAGGCACTGCAGAAAGTGGGCCTGAGCCTC
GAGGATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGA
ACGCCTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAG
ACTCTTGAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGA
ACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTC
ATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTG
GTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTG
TCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACAC
AATTGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAA
AGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCA
CGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTT
TCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTT
CTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCG
GACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGA
TGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATT
TTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAA
GGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGAT
GGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCA
CATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCA
AGCAGGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCAACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGA
GCCATCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAACTGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCT
CAGTTACGTGAATACTACAGAAGAGAAATTTTCAGACAACATTTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTA
TTCTGCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACATAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAA
TATTTTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGATAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAAC
ACTAGAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCATGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTA
TCACTGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTATCAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTA
TCTTCTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCAGTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACC
TTTAAAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAATGCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCAT
TAAAGAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAACTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAA
AATCCAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAA
AATAGATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTG
TGTTAGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGG
GCATATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTGGAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCAT
AGCAAAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGACTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCT
TAATCGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAGTGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCA
TCTAAGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGGGCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGT
CCGATTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAATGGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTAC
TACCCCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTC
AGAACAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAAGAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATT
TTTGTGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTCAGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAA
TGAAATGTTCACCCTAACTACCAATGGGGACCTACCCCGACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAAC
TGAGAAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCG
AAAAATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGT
GCATACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCA
TGCCCAGGATTGTGACGACAGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCC
ATGGTATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCC
CACAGCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGTTGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGA
GCCCATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGAC
CCACTGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCCACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCG
GTGGATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAGTTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCA
GCATAAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCCCAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGC
TGGGGAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACTCAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAG
AAAAAGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCT
GCCCCAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGAGAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCT
GGCTGACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCAACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGG
ATTCCTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAG
AGAAGATACTCGTATTAAGCCTATTTATAATCTATATGCAATTTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGC
CAAAAACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAGCTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACAT
TCTTTTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCTGCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGA
AGACTTTGAGTCTGATTACAAAAAGTACTGTGTGTTACAGTAAAGCTACCACTCTGGCTGCTAGACAGCTTGGCGGTGAGGGAGATGACT
CCTTGTAGCTGACATTTGGCAAAAGCGTCACTGAAAGGCAAGCTAAATGTAGTTATTTTATCCTGTGGCCCTGAAGCACAAAATAAAAAT

>In-frame_CDC27_ENST00000531206_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5424nt
GAGGATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGA
ACGCCTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAG
ACTCTTGAAAGGACACAGTTGTACTACACCGCAATGCAAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGA
ACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTC
ATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTG
GTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTG
TCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACAC
AATTGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAA
AGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCA
CGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTT
TCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTT
CTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCG
GACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGA
TGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATT
TTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAA
GGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGAT
GGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCA
CATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCA
AGCAGGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCAACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGA
GCCATCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAACTGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCT
CAGTTACGTGAATACTACAGAAGAGAAATTTTCAGACAACATTTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTA
TTCTGCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACATAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAA
TATTTTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGATAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAAC
ACTAGAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCATGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTA
TCACTGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTATCAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTA
TCTTCTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCAGTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACC
TTTAAAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAATGCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCAT
TAAAGAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAACTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAA
AATCCAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAA
AATAGATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTG
TGTTAGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGG
GCATATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTGGAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCAT
AGCAAAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGACTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCT
TAATCGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAGTGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCA
TCTAAGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGGGCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGT
CCGATTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAATGGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTAC
TACCCCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTC
AGAACAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAAGAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATT
TTTGTGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTCAGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAA
TGAAATGTTCACCCTAACTACCAATGGGGACCTACCCCGACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAAC
TGAGAAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCG
AAAAATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGT
GCATACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCA
TGCCCAGGATTGTGACGACAGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCC
ATGGTATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCC
CACAGCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGTTGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGA
GCCCATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGAC
CCACTGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCCACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCG
GTGGATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAGTTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCA
GCATAAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCCCAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGC
TGGGGAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACTCAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAG
AAAAAGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCT
GCCCCAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGAGAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCT
GGCTGACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCAACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGG
ATTCCTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAG
AGAAGATACTCGTATTAAGCCTATTTATAATCTATATGCAATTTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGC
CAAAAACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAGCTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACAT
TCTTTTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCTGCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGA
AGACTTTGAGTCTGATTACAAAAAGTACTGTGTGTTACAGTAAAGCTACCACTCTGGCTGCTAGACAGCTTGGCGGTGAGGGAGATGACT
CCTTGTAGCTGACATTTGGCAAAAGCGTCACTGAAAGGCAAGCTAAATGTAGTTATTTTATCCTGTGGCCCTGAAGCACAAAATAAAAAT

>In-frame_CDC27_ENST00000527547_chr17_45234596_-_USP32_ENST00000300896_chr17_58379065_-_5472nt
CCGCTACAGGGGGGGCCTGAGGCACTGCAGAAAGTGGGCCTGAGCCTCGAGGATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATG
GCAAGCACTAAACCACTATGCTTACCGAGATGCGGTTTTCCTCGCAGAACGCCTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTT
ACTGGCAACCTGTTATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTCTTGAAAGGACACAGTTGTACTACACCGCAATGCAAATA
CCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGAACAAATCTTATCTGGTGGAGTGTTTAATAAGCAGAAAAGCCA
TGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTACTCTTTCATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAA
AGGATCAGAATGTTACCAAAAGAGCCTTAGTTTAAATCCTTTCCTCTGGTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGA
TCCTGACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTGCCCAACTCTTGCACAACACAAGTACCTAATCATAGTTT
ATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATTGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCT
GCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAAAGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAG
TGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTT
CTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATC
TGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGA
CATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCGGACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTC
ACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGATGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTG
TGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTC
CAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCT
CTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAA
AAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGG
ACAAATTATTAGAGGATGGTTAGAACGAGAGAGCAGGTATGGTCTGCAAGCAGGACACAACTGGTTTATCATCTCCATGCAGTGGTGGCA
ACAGTGGAAAGAATATGTCAAATACGATGCCAACCCTGTGGTAATTGAGCCATCATCTGTTTTGAATGGAGGAAAATACTCATTTGGAAC
TGCAGCCCATCCTATGGAGCAGGTCGAAGATAGAATTGGAAGCAGCCTCAGTTACGTGAATACTACAGAAGAGAAATTTTCAGACAACAT
TTCTACTGCATCTGAAGCCTCAGAAACTGCTGGCAGCGGCTTTCTGTATTCTGCCACACCAGGGGCAGATGTTTGCTTTGCTCGACAACA
TAACACTTCTGACAATAACAACCAGTGTTTGCTGGGAGCCAATGGGAATATTTTGTTGCACCTTAACCCTCAGAAACCAGGGGCTATTGA
TAATCAGCCATTAGTAACTCAAGAACCAGTAAAGGCTACATCATTAACACTAGAAGGAGGACGATTAAAACGAACTCCACAGCTGATTCA
TGGAAGAGACTATGAAATGGTCCCAGAACCTGTGTGGAGAGCACTTTATCACTGGTATGGAGCAAACCTGGCCTTACCTAGACCAGTTAT
CAAGAACAGCAAGACAGACATCCCAGAGCTGGAATTATTTCCCCGCTATCTTCTCTTCCTGAGACAGCAGCCTGCCACTCGGACACAGCA
GTCTAACATCTGGGTGAATATGGGAAATGTACCTTCTCCGAATGCACCTTTAAAGCGGGTATTAGCCTATACAGGCTGTTTTAGTCGAAT
GCAGACCATCAAGGAAATTCACGAATATCTATCTCAAAGGCTGCGCATTAAAGAGGAAGATATGCGCCTGTGGCTATACAACAGTGAGAA
CTACCTTACTCTTCTGGATGATGAGGATCATAAATTGGAATATTTGAAAATCCAGGATGAACAACACCTGGTAATTGAAGTTCGCAACAA
AGATATGAGTTGGCCTGAGGAGATGTCTTTTATAGCAAATAGTAGTAAAATAGATAGACACAAGGTTCCCACAGAAAAGGGAGCCACAGG
TCTAAGCAATCTGGGAAACACATGCTTCATGAACTCAAGCATCCAGTGTGTTAGTAACACACAGCCACTGACACAGTATTTTATCTCAGG
GAGACATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGGGCATATGGCTAAATGCTATGGTGATTTAGTGCAGGAACTTTG
GAGTGGAACTCAGAAGAATGTTGCCCCATTAAAGCTTCGGTGGACCATAGCAAAATATGCTCCCAGGTTTAATGGGTTTCAGCAACAGGA
CTCCCAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTTAATCGAGTCCATGAAAAGCCATATGTGGAACTGAAGGACAG
TGATGGGCGACCAGACTGGGAAGTAGCTGCAGAGGCCTGGGACAACCATCTAAGAAGAAATAGATCAATTGTTGTGGATTTGTTCCATGG
GCAGCTAAGATCTCAAGTAAAATGCAAGACATGTGGGCATATAAGTGTCCGATTTGACCCTTTCAATTTTTTGTCTTTGCCACTACCAAT
GGACAGTTATATGCACTTAGAAATAACAGTGATTAAGTTAGATGGTACTACCCCTGTACGGTATGGACTAAGACTGAATATGGATGAAAA
GTACACAGGTTTAAAAAAACAGCTGAGTGATCTCTGTGGACTTAATTCAGAACAAATCCTTCTAGCAGAAGTACATGGTTCCAACATAAA
GAACTTTCCTCAGGACAACCAAAAAGTACGACTCTCAGTGAGTGGATTTTTGTGTGCATTTGAAATTCCTGTCCCTGTGTCTCCAATTTC
AGCTTCTAGTCCAACACAGACAGATTTCTCCTCTTCGCCATCTACAAATGAAATGTTCACCCTAACTACCAATGGGGACCTACCCCGACC
AATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAACTGAGAAGAACTTCACAAATGGAATGGTTAATGGTCACATGCC
ATCTCTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCGAAAAATGATGAGGACAGAACTGTATTTCCTGTCATCTCAGAA
GAATCGCCCCAGCCTCTTTGGAATGCCATTGATTGTTCCATGTACTGTGCATACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCA
AGTATCCCGGTTAGCGAGCCCACTCCCACCTCAGGAAGCTAGTAATCATGCCCAGGATTGTGACGACAGTATGGGCTATCAATATCCATT
CACTCTACGAGTTGTGCAGAAAGATGGGAACTCCTGTGCTTGGTGCCCATGGTATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGA
AGACAGAGCTTTCATTGGAAATGCCTATATCGCTGTGGATTGGGATCCCACAGCCCTTCACCTTCGCTATCAAACATCCCAGGAAAGGGT
TGTAGATGAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGAGCCCATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGA
GGAAGAGCTAGGGGAAAATGAGATGTACTACTGTTCCAAGTGTAAGACCCACTGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTTCC
ACCCATCCTGATTATTCACCTTAAGCGATTTCAATTTGTAAATGGTCGGTGGATAAAATCACAGAAAATTGTCAAATTTCCTCGGGAAAG
TTTTGATCCAAGTGCTTTTTTGGTACCAAGAGACCCGGCTCTCTGCCAGCATAAACCACTCACACCCCAGGGGGATGAGCTCTCTGAGCC
CAGGATTCTGGCAAGGGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGCTGGGGAAGAGGACGTGCTCCTGAGCAAAAGCCCATCCTCACT
CAGCGCTAACATCATCAGCAGCCCGAAAGGTTCTCCTTCTTCATCAAGAAAAAGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCCC
TAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCTGCCCCAGATTGGCAGCAAAAATAAACTGTCAAGTAGTAAAGA
GAACTTGGATGCCAGCAAAGAAAATGGGGCTGGGCAGATATGTGAGCTGGCTGACGCCTTGAGTCGAGGGCATGTGCTGGGGGGCAGCCA
ACCAGAGTTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGGATTCCTTTATGAGCATGAAGCATGTGGCAATGGCTACAGCAA
TGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAGAGAAGATACTCGTATTAAGCCTATTTATAATCTATATGCAAT
TTCGTGCCATTCAGGAATTCTGGGTGGGGGCCATTACGTCACTTATGCCAAAAACCCAAACTGCAAGTGGTACTGTTACAATGACAGCAG
CTGTAAGGAACTTCACCCGGATGAAATTGACACCGACTCTGCCTACATTCTTTTCTATGAGCAGCAGGGGATAGACTATGCACAATTTCT
GCCAAAGACTGATGGCAAAAAGATGGCAGACACAAGCAGTATGGATGAAGACTTTGAGTCTGATTACAAAAAGTACTGTGTGTTACAGTA
AAGCTACCACTCTGGCTGCTAGACAGCTTGGCGGTGAGGGAGATGACTCCTTGTAGCTGACATTTGGCAAAAGCGTCACTGAAAGGCAAG


Top

FusionGenePPI for CDC27_USP32


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDC27ANAPC1, ANAPC10, ANAPC11, ANAPC4, ANAPC5, CDC16, ANAPC7, CDC23, CDC20, SPATC1, FZR1, PPP5C, SMAD3, SMAD2, PIN1, MAD2L1, BUB1B, CDC26, CDKN1A, TTK, USP11, PTTG1, CCNB1, CTNNB1, ANAPC2, MDC1, CREBBP, HSF2, UBE2S, ANAPC16, BUB3, CKS1B, SMARCAD1, SH3KBP1, CUEDC2, RB1, NINL, FOXM1, CDC27, FBXO5, AURKB, USP37, ANAPC13, EMILIN1, MCPH1, NEK2, MAD1L1, MAD2L1BP, UBE4B, PAXIP1, TP53BP1, NOTCH1, ANAPC15, MAD2L2, REV1, TRIM33, VCP, PTEN, GKN1, DCPS, ADNP, PHF8, MIB1, HECW2, BIRC6, FBXO43, COMT, E2F1, TFDP1, CDH1, CCNA2, SIRT6, PENK, GRAP2, MAGIX, EPN3, RRM2, TTLL1, DCLRE1C, NTRK1, NCL, RPL5, TAF4, TAF5, KRAS, CFAP97, XPO1, CHD8, ZNF526, RBPJ, TEAD2, FOXE1, FOXO3, FOXP3, FOXQ1, SNW1, CDC5L, PPP2R5A, PPP2CA, PCNA, CCND1, ELMO1, ELMO2, C16orf87, ANO6, RNF19B, ZNF408, KIF2B, FDPS, SRP68, RSBN1, TACC3, NUP98, HOXD13, LNP1, HHEXUSP32CDK1, FARSA, KRT8, KRT18, KRT19, ABCD3, YWHAB, TUBA1A, SMC1A, USP6, TRIP13, ERP44, UBXN1, MRPL39, VPS35, LRRC47, USP32P2, USP4, CUL3, CAND1, RBCK1, TRIM46, RNF144A, TRIM74, ZDHHC17, RAP1B, SORT1, SYNCRIP, BAG6, FDFT1, RAB6B, TPCN2, MANSC1, ENTPD7, ALDH3B1, CD83, NME4, HSPA12A, UBC, MTNR1A, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDC27_USP32


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDC27_USP32


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource