FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6317

FusionGeneSummary for CDC20_DEF8

check button Fusion gene summary
Fusion gene informationFusion gene name: CDC20_DEF8
Fusion gene ID: 6317
HgeneTgene
Gene symbol

CDC20

DEF8

Gene ID

991

54849

Gene namecell division cycle 20differentially expressed in FDCP 8 homolog
SynonymsCDC20A|bA276H19.3|p55CDC-
Cytomap

1p34.2

16q24.3

Type of geneprotein-codingprotein-coding
Descriptioncell division cycle protein 20 homologCDC20 cell division cycle 20 homologcell division cycle 20 homologdifferentially expressed in FDCP 8 homologDEF-8
Modification date2018052220180519
UniProtAcc

Q12834

Q6ZN54

Ensembl transtripts involved in fusion geneENST00000310955, ENST00000372462, 
ENST00000478882, 
ENST00000563594, 
ENST00000268676, ENST00000569453, 
ENST00000418391, ENST00000567874, 
ENST00000570182, ENST00000563795, 
ENST00000563848, 
Fusion gene scores* DoF score3 X 3 X 3=271 X 1 X 1=1
# samples 31
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: CDC20 [Title/Abstract] AND DEF8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDC20

GO:0031145

anaphase-promoting complex-dependent catabolic process

17443180

HgeneCDC20

GO:1904668

positive regulation of ubiquitin protein ligase activity

11459826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-BR-4255-01ACDC20chr1

43825454

+DEF8chr16

90025552

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000310955ENST00000563594CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000310955ENST00000268676CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000310955ENST00000569453CDC20chr1

43825454

+DEF8chr16

90025552

+
In-frameENST00000310955ENST00000418391CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000310955ENST00000567874CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000310955ENST00000570182CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000310955ENST00000563795CDC20chr1

43825454

+DEF8chr16

90025552

+
5CDS-3UTRENST00000310955ENST00000563848CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000563594CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000268676CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000569453CDC20chr1

43825454

+DEF8chr16

90025552

+
In-frameENST00000372462ENST00000418391CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000567874CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000570182CDC20chr1

43825454

+DEF8chr16

90025552

+
Frame-shitENST00000372462ENST00000563795CDC20chr1

43825454

+DEF8chr16

90025552

+
5CDS-3UTRENST00000372462ENST00000563848CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000563594CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000268676CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000569453CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000418391CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000567874CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000570182CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3CDSENST00000478882ENST00000563795CDC20chr1

43825454

+DEF8chr16

90025552

+
3UTR-3UTRENST00000478882ENST00000563848CDC20chr1

43825454

+DEF8chr16

90025552

+

Top

FusionProtFeatures for CDC20_DEF8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDC20

Q12834

DEF8

Q6ZN54

Required for full ubiquitin ligase activity of theanaphase promoting complex/cyclosome (APC/C) and may confersubstrate specificity upon the complex. Is regulated by MAD2L1: inmetaphase the MAD2L1-CDC20-APC/C ternary complex is inactive andin anaphase the CDC20-APC/C binary complex is active in degradingsubstrates. The CDC20-APC/C complex positively regulates theformation of synaptic vesicle clustering at active zone to thepresynaptic membrane in postmitotic neurons. CDC20-APC/C-induceddegradation of NEUROD2 induces presynaptic differentiation.{ECO:0000269|PubMed:9637688, ECO:0000269|PubMed:9734353,ECO:0000269|PubMed:9811605}. Positively regulates lysosome peripheral distributionand ruffled border formation in osteoclasts. Involved in boneresorption. {ECO:0000250|UniProtKB:Q99J78}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CDC20_DEF8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDC20_ENST00000310955_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_186aa
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRTIPHRSAAQMEV
ASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGTPVWWPLAKHGQSKLN_LNMHFLVVLSTLDRAVLDEK

>In-frame_CDC20_ENST00000372462_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_186aa
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRTIPHRSAAQMEV
ASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGTPVWWPLAKHGQSKLN_LNMHFLVVLSTLDRAVLDEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDC20_ENST00000310955_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_558nt
ATGGCACAGTTCGCGTTCGAGAGTGACCTGCACTCGCTGCTTCAGCTGGATGCACCCATCCCCAATGCACCCCCTGCGCGCTGGCAGCGC
AAAGCCAAGGAAGCCGCAGGCCCGGCCCCCTCACCCATGCGGGCCGCCAACCGATCCCACAGCGCCGGCAGGACTCCGGGCCGAACTCCT
GGCAAATCCAGTTCCAAGGTTCAGACCACTCCTAGCAAACCTGGCGGTGACCGCTATATCCCCCATCGCAGTGCTGCCCAGATGGAGGTG
GCCAGCTTCCTCCTGAGCAAGGAGAACCAGCCTGAAAACAGCCAGACGCCCACCAAGAAGGAACATCAGAAAGCCTGGGCTTTGAACCTG
AACGGTTTTGATGTAGAGGAAGCCAAGATCCTTCGGCTCAGTGGAAAACCACAAAATGCGCCAGAGGGCTATCCAGTGTGGTGGCCACTA
GCCAAACATGGCCAGTCAAAGTTAAATTAACTAAATATGCATTTCCTCGTTGTACTGTCTACATTGGACAGGGCTGTTCTGGATGAGAAA

>In-frame_CDC20_ENST00000372462_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_558nt
ATGGCACAGTTCGCGTTCGAGAGTGACCTGCACTCGCTGCTTCAGCTGGATGCACCCATCCCCAATGCACCCCCTGCGCGCTGGCAGCGC
AAAGCCAAGGAAGCCGCAGGCCCGGCCCCCTCACCCATGCGGGCCGCCAACCGATCCCACAGCGCCGGCAGGACTCCGGGCCGAACTCCT
GGCAAATCCAGTTCCAAGGTTCAGACCACTCCTAGCAAACCTGGCGGTGACCGCTATATCCCCCATCGCAGTGCTGCCCAGATGGAGGTG
GCCAGCTTCCTCCTGAGCAAGGAGAACCAGCCTGAAAACAGCCAGACGCCCACCAAGAAGGAACATCAGAAAGCCTGGGCTTTGAACCTG
AACGGTTTTGATGTAGAGGAAGCCAAGATCCTTCGGCTCAGTGGAAAACCACAAAATGCGCCAGAGGGCTATCCAGTGTGGTGGCCACTA
GCCAAACATGGCCAGTCAAAGTTAAATTAACTAAATATGCATTTCCTCGTTGTACTGTCTACATTGGACAGGGCTGTTCTGGATGAGAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDC20_ENST00000310955_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_815nt
GAGGCTGTGATGGGTTGACAGGTGCGTGACAGTGGGAGCTGCTCTCGGCACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGT
CCCGTCCGACAGCCAGGCCCGGGAGAAGGCTCCGTAGGCACCAACTGCAAGGACCCCTCCCCCTGCGGGCGCTCCCATGGCACAGTTCGC
GTTCGAGAGTGACCTGCACTCGCTGCTTCAGCTGGATGCACCCATCCCCAATGCACCCCCTGCGCGCTGGCAGCGCAAAGCCAAGGAAGC
CGCAGGCCCGGCCCCCTCACCCATGCGGGCCGCCAACCGATCCCACAGCGCCGGCAGGACTCCGGGCCGAACTCCTGGCAAATCCAGTTC
CAAGGTTCAGACCACTCCTAGCAAACCTGGCGGTGACCGCTATATCCCCCATCGCAGTGCTGCCCAGATGGAGGTGGCCAGCTTCCTCCT
GAGCAAGGAGAACCAGCCTGAAAACAGCCAGACGCCCACCAAGAAGGAACATCAGAAAGCCTGGGCTTTGAACCTGAACGGTTTTGATGT
AGAGGAAGCCAAGATCCTTCGGCTCAGTGGAAAACCACAAAATGCGCCAGAGGCACCTGCACAGGTGGGCCGAGACCCAGACGAGGAGTG
AGGAATGAGAGAGACCAAAGTTCCTGCCTCCGCTGGGCTCACATTCAGATGTGAGCTATCCAGTGTGGTGGCCACTAGCCAAACATGGCC
AGTCAAAGTTAAATTAACTAAATATGCATTTCCTCGTTGTACTGTCTACATTGGACAGGGCTGTTCTGGATGAGAAATTAAACTAGTGAA

>In-frame_CDC20_ENST00000372462_chr1_43825454_+_DEF8_ENST00000418391_chr16_90025552_+_585nt
GAGGCTGTGATGGGTTGACAGGTGCGTGACAGTGGGAGCTGCTCTCGGCACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGT
CCCGTCCGACAGCCAGGCCCGGGAGAAGCAAATCCAGTTCCAAGGTTCAGACCACTCCTAGCAAACCTGGCGGTGACCGCTATATCCCCC
ATCGCAGTGCTGCCCAGATGGAGGTGGCCAGCTTCCTCCTGAGCAAGGAGAACCAGCCTGAAAACAGCCAGACGCCCACCAAGAAGGAAC
ATCAGAAAGCCTGGGCTTTGAACCTGAACGGTTTTGATGTAGAGGAAGCCAAGATCCTTCGGCTCAGTGGAAAACCACAAAATGCGCCAG
AGGCACCTGCACAGGTGGGCCGAGACCCAGACGAGGAGTGAGGAATGAGAGAGACCAAAGTTCCTGCCTCCGCTGGGCTCACATTCAGAT
GTGAGCTATCCAGTGTGGTGGCCACTAGCCAAACATGGCCAGTCAAAGTTAAATTAACTAAATATGCATTTCCTCGTTGTACTGTCTACA


Top

FusionGenePPI for CDC20_DEF8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDC20KRT85, KRT31, KRT32, CCDC59, YARS2, KRTAP19-5, KRTAP9-3, KRTAP9-2, KRT33A, HDAC1, HDAC2, MAD2L1, MAD2L2, CDC27, SPATC1, BUB1B, AURKA, CDC16, FBXO5, CCNA1, CDC23, CDC20, ANAPC10, ANAPC11, ANAPC1, ANAPC7, CDT1, CDKN1A, UBE2C, KDM5B, CREBBP, EP300, FZR1, ANAPC2, CCNA2, IST1, FBXW5, RASSF1, PIM1, SKP2, BUB3, TAS2R13, HSF1, CCNB1, HSF2, TTK, UBE2S, CDR2, TK1, CDC6, ANAPC4, MXI1, CUEDC2, ID1, NINL, PTTG1, CLSPN, RNF34, CKS1B, MDC1, MAD2L1BP, BTRC, AURKB, USP37, COPS5, GMNN, APP, PAXIP1, ANAPC15, TRRAP, DAXX, TRIM33, ANAPC5, NEK2, PLK1, TP73, SIRT2, HDAC6, TUBG1, AXIN2, PHF8, HECW2, MAD1L1, CDK2, STAU1, TUBA1A, TUBB, CCT6A, TUBB4B, CCT5, CCT8, CCT2, TUBB2A, HSPA8, TCP1, HSPD1, CCT3, CCT4, TUBA1C, CDC26, CCT7, HSPA5, RPS3, CPVL, CAPNS1, RAVER1, HSPA9, FGFR1, HSPA1A, DSC1, PBRM1, HSPA1L, RPL23, TUBA4A, UBB, HNRNPF, FRY, ANAPC16, EIF2A, CILP, BUB1, FBXO43, CHFR, MOV10, E2F1, TFDP1, CDK1, KIF18A, SPINT2, PLEKHO2, UBR5, CEP128, XPO1, RNH1, HUWE1, TRIP13, PARK2, YBX1, CDC5L, UBC, PPP2R5E, PPP2CA, PPP2CB, PPP2R1A, CASC5, PCNA, PPP2R5A, DCPS, USP22, CDC25A, CDC25B, SSSCA1, CKS2, PCDHAC2, YAP1, CCNF, BANP, NUP98, HOXD13, LNP1, HHEXDEF8WDFY3, PKN3, APAF1, PLCB1, RADIL, HPS5, KDM5C, MSTO1, ZMYM6, STIL, MCM8, C5orf22, TUBE1, PPIP5K2, NRD1, IFT122, EIF2AK4, DTL, GFER, PKN2, DMXL2, TRIP6, DPYSL4, TUBB3, DSTYK, ALMS1, ATG2B, PASK, ZNHIT2, UHRF1BP1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDC20_DEF8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDC20_DEF8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource