FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6247

FusionGeneSummary for CD74_IQCE

check button Fusion gene summary
Fusion gene informationFusion gene name: CD74_IQCE
Fusion gene ID: 6247
HgeneTgene
Gene symbol

CD74

IQCE

Gene ID

972

23288

Gene nameCD74 moleculeIQ motif containing E
SynonymsDHLAG|HLADG|II|Ia-GAMMA1700028P05Rik|PAPA7
Cytomap

5q33.1

7p22.3

Type of geneprotein-codingprotein-coding
DescriptionHLA class II histocompatibility antigen gamma chainCD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)CD74 molecule, major histocompatibility complex, class II invariant chainHLA-DR antigens-associated IQ domain-containing protein E
Modification date2018052220180519
UniProtAcc

P04233

Q6IPM2

Ensembl transtripts involved in fusion geneENST00000377795, ENST00000353334, 
ENST00000524315, ENST00000009530, 
ENST00000404984, ENST00000402050, 
ENST00000438376, ENST00000325979, 
ENST00000497572, 
Fusion gene scores* DoF score33 X 31 X 10=1023012 X 3 X 9=324
# samples 4812
** MAII scorelog2(48/10230*10)=-4.41362792902417
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/324*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CD74 [Title/Abstract] AND IQCE [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCD74

GO:0001516

prostaglandin biosynthetic process

12782713

HgeneCD74

GO:0001934

positive regulation of protein phosphorylation

24942581

HgeneCD74

GO:0002792

negative regulation of peptide secretion

19849849

HgeneCD74

GO:0007165

signal transduction

12782713

HgeneCD74

GO:0008283

cell proliferation

12782713

HgeneCD74

GO:0033674

positive regulation of kinase activity

24942581

HgeneCD74

GO:0043066

negative regulation of apoptotic process

12782713

HgeneCD74

GO:0043123

positive regulation of I-kappaB kinase/NF-kappaB signaling

24942581

HgeneCD74

GO:0043410

positive regulation of MAPK cascade

24942581

HgeneCD74

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

17045821

HgeneCD74

GO:0045657

positive regulation of monocyte differentiation

24942581

HgeneCD74

GO:0045893

positive regulation of transcription, DNA-templated

24942581

HgeneCD74

GO:0046598

positive regulation of viral entry into host cell

24942581

HgeneCD74

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

17045821

HgeneCD74

GO:0051290

protein heterotetramerization

24942581

HgeneCD74

GO:0070374

positive regulation of ERK1 and ERK2 cascade

17045821|24942581


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7854-01ACD74chr5

149781200

-IQCEchr7

2641075

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377795ENST00000404984CD74chr5

149781200

-IQCEchr7

2641075

+
In-frameENST00000377795ENST00000402050CD74chr5

149781200

-IQCEchr7

2641075

+
In-frameENST00000377795ENST00000438376CD74chr5

149781200

-IQCEchr7

2641075

+
In-frameENST00000377795ENST00000325979CD74chr5

149781200

-IQCEchr7

2641075

+
5CDS-intronENST00000377795ENST00000497572CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000353334ENST00000404984CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000353334ENST00000402050CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000353334ENST00000438376CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000353334ENST00000325979CD74chr5

149781200

-IQCEchr7

2641075

+
intron-intronENST00000353334ENST00000497572CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000524315ENST00000404984CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000524315ENST00000402050CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000524315ENST00000438376CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000524315ENST00000325979CD74chr5

149781200

-IQCEchr7

2641075

+
intron-intronENST00000524315ENST00000497572CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000009530ENST00000404984CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000009530ENST00000402050CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000009530ENST00000438376CD74chr5

149781200

-IQCEchr7

2641075

+
intron-3CDSENST00000009530ENST00000325979CD74chr5

149781200

-IQCEchr7

2641075

+
intron-intronENST00000009530ENST00000497572CD74chr5

149781200

-IQCEchr7

2641075

+

Top

FusionProtFeatures for CD74_IQCE


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CD74

P04233

IQCE

Q6IPM2

Component of the EvC complex that positively regulatesciliary Hedgehog (Hh) signaling. {ECO:0000250|UniProtKB:Q6PCQ0}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCD74chr5:149781200chr7:2641075ENST00000377795-66210_271372280DomainThyroglobulin type-1
HgeneCD74chr5:149781200chr7:2641075ENST00000377795-66103_117372280RegionNote=CLIP
HgeneCD74chr5:149781200chr7:2641075ENST00000377795-661_46372280Topological domainCytoplasmic
HgeneCD74chr5:149781200chr7:2641075ENST00000377795-6673_296372280Topological domainExtracellular
HgeneCD74chr5:149781200chr7:2641075ENST00000377795-6647_72372280TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420534_539471631Compositional biasNote=Poly-Lys
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622534_539536696Compositional biasNote=Poly-Lys
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521534_539485645Compositional biasNote=Poly-Lys
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521534_539520680Compositional biasNote=Poly-Lys
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420542_571471631DomainIQ 1
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420601_630471631DomainIQ 2
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622542_571536696DomainIQ 1
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622601_630536696DomainIQ 2
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521542_571485645DomainIQ 1
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521601_630485645DomainIQ 2
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521542_571520680DomainIQ 1
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521601_630520680DomainIQ 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCD74chr5:149781200chr7:2641075ENST00000009530-19210_271-1297DomainThyroglobulin type-1
HgeneCD74chr5:149781200chr7:2641075ENST00000353334-18210_271-60233DomainThyroglobulin type-1
HgeneCD74chr5:149781200chr7:2641075ENST00000009530-19103_117-1297RegionNote=CLIP
HgeneCD74chr5:149781200chr7:2641075ENST00000353334-18103_117-60233RegionNote=CLIP
HgeneCD74chr5:149781200chr7:2641075ENST00000009530-191_46-1297Topological domainCytoplasmic
HgeneCD74chr5:149781200chr7:2641075ENST00000009530-1973_296-1297Topological domainExtracellular
HgeneCD74chr5:149781200chr7:2641075ENST00000353334-181_46-60233Topological domainCytoplasmic
HgeneCD74chr5:149781200chr7:2641075ENST00000353334-1873_296-60233Topological domainExtracellular
HgeneCD74chr5:149781200chr7:2641075ENST00000009530-1947_72-1297TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneCD74chr5:149781200chr7:2641075ENST00000353334-1847_72-60233TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420157_264471631Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420292_358471631Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000325979+1420387_477471631Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622157_264536696Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622292_358536696Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000402050+1622387_477536696Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521157_264485645Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521292_358485645Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000404984+1521387_477485645Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521157_264520680Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521292_358520680Coiled coilOntology_term=ECO:0000255
TgeneIQCEchr5:149781200chr7:2641075ENST00000438376+1521387_477520680Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for CD74_IQCE


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000404984_chr7_2641075_+_160aa
KKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGK

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000402050_chr7_2641075_+_160aa
KKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGK

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000438376_chr7_2641075_+_160aa
KKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGK

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000325979_chr7_2641075_+_160aa
KKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000404984_chr7_2641075_+_480nt
AAAAAAAAGGCTGTTCTGGATGAGGCGGCTGTGGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAA
GCACATGGCTCAGAGCCACCCAGCGTGCCAGGCCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACG
GGCAGCCCTGTGCAGGAGGAGGCCATCGTCATCATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAA
AGAACCACCACCGCAGCTTCTACCAGGAGGAGATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCT
GACCCCTCTCCCTCAGGGCCACAGGCCTTGGCACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCG

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000402050_chr7_2641075_+_480nt
AAAAAAAAGGCTGTTCTGGATGAGGCGGCTGTGGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAA
GCACATGGCTCAGAGCCACCCAGCGTGCCAGGCCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACG
GGCAGCCCTGTGCAGGAGGAGGCCATCGTCATCATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAA
AGAACCACCACCGCAGCTTCTACCAGGAGGAGATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCT
GACCCCTCTCCCTCAGGGCCACAGGCCTTGGCACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCG

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000438376_chr7_2641075_+_480nt
AAAAAAAAGGCTGTTCTGGATGAGGCGGCTGTGGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAA
GCACATGGCTCAGAGCCACCCAGCGTGCCAGGCCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACG
GGCAGCCCTGTGCAGGAGGAGGCCATCGTCATCATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAA
AGAACCACCACCGCAGCTTCTACCAGGAGGAGATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCT
GACCCCTCTCCCTCAGGGCCACAGGCCTTGGCACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCG

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000325979_chr7_2641075_+_480nt
AAAAAAAAGGCTGTTCTGGATGAGGCGGCTGTGGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAA
GCACATGGCTCAGAGCCACCCAGCGTGCCAGGCCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACG
GGCAGCCCTGTGCAGGAGGAGGCCATCGTCATCATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAA
AGAACCACCACCGCAGCTTCTACCAGGAGGAGATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCT
GACCCCTCTCCCTCAGGGCCACAGGCCTTGGCACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000404984_chr7_2641075_+_6189nt
CCGGGGGGTCAGGGTCCCAGATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTA
TCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTT
CCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCA
CCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGC
TGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGC
ACCTGCTCCAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCA
GCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCC
TGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGC
AAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATC
ACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCC
CAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCC
CTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGC
TTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAATAAAAGGTAGTAATTAGAACAAAAAAAAAGGCTGTTCTGGATGAGGCGGCTGT
GGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAAGCACATGGCTCAGAGCCACCCAGCGTGCCAGG
CCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACGGGCAGCCCTGTGCAGGAGGAGGCCATCGTCAT
CATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAAAGAACCACCACCGCAGCTTCTACCAGGAGGAG
ATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCTGACCCCTCTCCCTCAGGGCCACAGGCCTTGGC
ACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCGTCTCTGCCCACGAAGAACTTTCCAGTTTAGGT
CCCCGTCACTGTCTCCACGCCGTGATGGCAGCGCTGCCGAGGACATAGGAACCACGACTGGAAAGATAATTTATCGTGTTAGGAGAAGAA
CGATGATACCTACTTAACACCTCAGCATCTGCGTCGTGTCTCTTTGTGCTTTTGTTTGTGGAAGGAGACCCAAATGCCTTTACTTTATTC
TCTGGGGAGGGCCAGCGGCTCGCATCCCCCTCATCTCCAGCTGCAGCTCGGATGGTGGATTTTCAGTGCCAACAGACACATCTGCCGTGA
ACTCGCAGATGCCAGGGAGCCCTGTAGTGACACGTTCTCTGACAGCACCTTGCCGCCTGCCCACGACCTTGACCGTGAGGAGCTGCTATC
CGCAACCAGCGCCGACACCATGCCCCCTCTTCCTGGTGACACCCTCAACAACCAGGATTTGCTCGATCTCAGCCCAGCAGGCCAGGCAGA
CACACCCCGCTGTGCCTTAGGAAGGTGTGAGACCGGCTTCCCCCATCCCCACAGCAAAACACGGCCTGTCCCAAGCCAGTGAGGAGCTAA
AGACACCCAGGTCCCCAAATGATCTTACTCCATGCCCCACCCGCTCACACCGTCCTTTCCCGTCACCCTTGCTATCCCCTGGAGCACTGC
CCTCCAGAGCTGCCCTTCCCAGGAAGGAATTTGGTTGGATTCTGTCACTGTGGAGACCAAGATTTTTTAAAATTCCCAATTACAAAAGCA
GCATCACACTTGCTTCTGAGAACAGCAGGGTGATGTCTGTTCCCAAGCTGGTGGCGGGAGCCTTAGCCTGTGTGGGGCCACCCGGGGAAG
AGGAGGAGAGGAGGGTGAGGAGGCAGGCTCGCCGTTCCAAGGGACAGCATAGGCTCGTGGTGGGGCGTGTTGCATCTGGTGTCTGGGACA
GTCCCCGTCACCCCATGTGTGCGGCCTCTGCACTCCCAAGCTCCATGGCTGGGCTGGGCTGGGCTGGGCTGGGCTGGGCCGGGCGTGCGG
AGCCTGTGGAGCCAGCAGCTGCAGAGGCCTAGGAGGGAGTTCCTGGGGGAAGCGCACAGTGTCCAGTGCCCATCTCTTGCTTGTGTGTGA
GATTAGCCCTTGCTGGGGCGTCAAGAGGAAGAGCCTTAGACCTGGGCGGGCCTTCAGGGGCATCTAGACCCCTGCACAGCCCAGGCCTGG
TGTCTGCATTTCCACAGCACCCCTGTGGGGACTCCTGCCGGGGCTGGCCGCTGTCTCAGGAGAGACCCAATGGTTAGAAAGCCCCTTTTT
ACACAGCTGACAGCTTCTCCCAAGGCTTCCGTCCACGGGGACAGGCTTAACCCCTGGGCGCCTTTTCTGCAGCATGGCGGCCTTCTGAGT
CACCTAAGCTGAGCCTGGGTCATTCTCTGTGGCGGTCAGAAGGCCGATGGCCCCAACACAGTGGCTTGTGAAAGGGAGAGAGGAGGCTCT
GCATGTCCACCTGCTCTATGGGAGGAGGACACAGGTGTCCCCAGCCCAGCCTGTTCTCTCCCAGTCACTCAGGGATGGGGCCACCCAAAG
TGCAGGACCCGCCCCACCCTGCGGTTCGAAGCCTGGCCCCTGTCTCCACTTAGCTTCTGTTTCTGCAGTGGGTGGAAGCGAGTCAGCGGG
GGGCCTGGCTTGTGTACGTGTTTTCCTTATTTGGTCTGTGGGTTGCCAAGTCCATTTTTTTTTCCACTGAACTGGCTGGTAACTTGATGG
ACTGTGTAACTGACACAGGCCCTCTTTAGACCCCTGCCTTCACCCCACCCGCCCGGGTCCACTCCCTGGGGCGCTGTCCCAAGCCATCCC
TGCTTGCCAGCTCAAAGCTTCAGGTCCTAGGAGCCAGTCCACCTCGAAAGCCCTGAGAAAGTGAGACACCTGCACATTCGCTGGGGGAGA
CCCTCCGTTCTCTTGTGGCAGCTGCTCCCACTTGTTAAACCAAGCTGTTTCTGCGGGACGTGCTCACTCTTGGGAACCAGTGGCCTAGAG
CTTTGGGTTACAGGCATGGAGAGGGCTTTCCTGCCTCAGGCTTGGAGGCCAATGTTCCATACATAAACCGCCATGTCCTCTGGTGCAGCT
GGGCTGCTCTTTTAAAAGCCAGCATCCATCTTGAAGCTCGCTGGGTAAATGGCAATGCATTCTCAAGCCAGTGTCTTCAGCTGATGCCCA
GTGTCCAGTGCTGGTCACCAGTCCCCTTTGCTGGGTACAGCCTGCCTGGCTGTTCTGTGGTCCTGGAACGCTGCAGTGTGGTTTTGTTCC
ATGGAGACAGTACCAAGCGGAGAGGCCTCCTTGCCCACGGCCCCAGGGCCTGGGGGCCAGGGGTTCTGGCCCTGCGGGGACTTAGGCAGG
AGGGGAAGAGAAGCCCATGGAGCCATGGGAGGGGTGAGCTGTGGGCGGGGCCTAGTCATGGGAGGGGTGAGCTGTGGGCGGGGCGAGCTG
TGGGTGGGGCCTAGCCATGGGAGAGGTGAGCTGTGAATGGGGCTAGCTATGGGTGGGGTGAGCTGTGGACAGGGCCTAGCCATGGGAAAG
GTGAGCTGTGGGCGGGGCCTAGTCACGGGAGAGGTGAGCTGTGGGCGGGGCCTAGTCATGGGAGGGGTGAGCTGTGGATGGGGCCTAGCC
ATGGGAGGGGTGAGCTGTGAGTGGGGCTGAGCCATGGGAGCAGCAAGCTGGTGGAGTGGGCTGGGCGGAGCTGTGGGGGCTGCTGGCAGG
GCCTAGGAAAGTAGACAACTCCCGGGGGAGACGAAGTAGAGAGTGAGTCCCCAAGAAAGGGACTCCTGCCCCAGCGTCAAGTGCCAAAGC
AGGCCCCATCTACCACTTCAGGGTCGACGTTGGTGGCAGGTGTTGTTCACGGTGTACTGATTGTCACTGCAACACCTCCACATCACCTTG
AACTTCAAGAACAGCAGCAAAGCTGTATCTGCTATCAGAGGCTGTTAGGTAGTCCAGCTTTAAAATAACACACTCTTTCTCTATCCCATG
CCCTTTAAACAAGCAGCCACAGGAGATGTCAGTCTCCAGGGCCTGGCCCCACTGTGTTGACAGCAGTCACGTCTGTTGAGCTGACACTGC
TGAGGCTGAAGCTGGCCCCGTGCAGGTGGCTGGTGAGCCACAGGTGCAGTACCCGGAGGTGTGCTCTCCCCTAGAGGCCTGTCCCCAACT
CCTCCCCTAGAGGCCTATTCCCGCTGCTCACAGACCTCAGCAGAGGCACCAGCTGGAGGGCTCCAGGGACATCCTTGGAGATACAGGAGG
CTTTCCTGGCACAGGGCACAGCTCTTAGGAGGCCTTTGTAGGACGCTGTCTCCCCAGCGTGTCCTGCTCATCCAGGATGGGGAGAAAGAG
GAGGAGGCCCCAGGCTCAGAAGCCAGGGACAGACTGCCGACGATTACCAAACTGAATCCAGGCAGTGCCATGACCCTGGGTGTCCCTTGG
TTCACATCACCCACCAGACAGCTGCGGAGAGAGTGCAGGGAGGGGCTGGGACCAAACAGGCCAGAAACCAGCAGAAAAGAGGCAGAAGTG
AGGTGGGTGTGCCTGGGGCACGAAGCCAGCGCCGGGGGGATTTCAGTGGAGCCTTACAGCCAGGCTCCGTGCGGACTGTGATGCCAGAGA
GGCGTGCAGCCTCTGGGCAAGTCGGGAGAGGGCTTGGGTGGTCCCCACAAGGCAGAAGAGGTGGAAGGGCCAGAGAAGACCACCAAGACC
ACCGTTCCCGCAGGCCTGGGGTGAGTGACCTGACTGAGACTAGCGGGCAGAGCCAAGCAGGGCTAAACTCCAACCCAGGGCCCGGTGTTG
GACAAAGTAGCTTTTTCTTTGCTCGTTTGTCTGTGTATTAAGAAGAGACTAAAATAGCCAAACGACGCTGGTCGCATGCGCTGGCTGTGG
TCTGTCTGCTGAATGTCTATTTTTGTCTCCTGACGAGACGTGAGGACCATGCCCTTGATCCCTCCGATGGACCAGAAACCCCCTTCCTTG
CAAAAAAAAGGCAATTGAATTAGGAAAAGATAGCCCAACCTAGCTCAGATCCACCAAGATAAGCACAGCAAAGCTTGGCTGCATTTTTGA
GGAATAAAAACCTGCAGAAAGCACCGATAACCTTCAAGATCTGAATGAGATTCTATTATAACCCGTCTAAACGATTGCAAAATTCCTCCT
TTGGTTTTGGAAGCAGCGTTTGCTCTCCCGTGGCTCGGATTCTCTGAGGACCAGGGAGTTGACACACAAACCCCGCCATGGGTCCGAGCC
AGCTATTTCTCAAGGCTCCCACCTCGCCAAGCTCCCAAGGGCCTGCTGGCAGTGCCTACGCTGTGCCAACTACCCTGTCTGGTACAGACC
ACGGCTGGGTAAGCACCCTTAAAAGCAACAGAAATGACGTCTGGAAGCTGAAATGTGAAACTGTCAAGATGGCTTAGGAGAGGAAGGAGT
GGACCCGCTGGTCTTTGGCATTTTGTATTTAGAATTATTCTAACTTTATACATAATGTATAGGCCGATCTTTTGGAAGGGATAAGGTTTT

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000402050_chr7_2641075_+_6190nt
CCGGGGGGTCAGGGTCCCAGATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTA
TCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTT
CCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCA
CCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGC
TGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGC
ACCTGCTCCAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCA
GCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCC
TGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGC
AAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATC
ACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCC
CAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCC
CTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGC
TTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAATAAAAGGTAGTAATTAGAACAAAAAAAAAGGCTGTTCTGGATGAGGCGGCTGT
GGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAAGCACATGGCTCAGAGCCACCCAGCGTGCCAGG
CCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACGGGCAGCCCTGTGCAGGAGGAGGCCATCGTCAT
CATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAAAGAACCACCACCGCAGCTTCTACCAGGAGGAG
ATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCTGACCCCTCTCCCTCAGGGCCACAGGCCTTGGC
ACCTCTACCTGGGGATGACGTCAACTCCGATGATTCCGACGATATTGTCATTGCACCGTCTCTGCCCACGAAGAACTTTCCAGTTTAGGT
CCCCGTCACTGTCTCCACGCCGTGATGGCAGCGCTGCCGAGGACATAGGAACCACGACTGGAAAGATAATTTATCGTGTTAGGAGAAGAA
CGATGATACCTACTTAACACCTCAGCATCTGCGTCGTGTCTCTTTGTGCTTTTGTTTGTGGAAGGAGACCCAAATGCCTTTACTTTATTC
TCTGGGGAGGGCCAGCGGCTCGCATCCCCCTCATCTCCAGCTGCAGCTCGGATGGTGGATTTTCAGTGCCAACAGACACATCTGCCGTGA
ACTCGCAGATGCCAGGGAGCCCTGTAGTGACACGTTCTCTGACAGCACCTTGCCGCCTGCCCACGACCTTGACCGTGAGGAGCTGCTATC
CGCAACCAGCGCCGACACCATGCCCCCTCTTCCTGGTGACACCCTCAACAACCAGGATTTGCTCGATCTCAGCCCAGCAGGCCAGGCAGA
CACACCCCGCTGTGCCTTAGGAAGGTGTGAGACCGGCTTCCCCCATCCCCACAGCAAAACACGGCCTGTCCCAAGCCAGTGAGGAGCTAA
AGACACCCAGGTCCCCAAATGATCTTACTCCATGCCCCACCCGCTCACACCGTCCTTTCCCGTCACCCTTGCTATCCCCTGGAGCACTGC
CCTCCAGAGCTGCCCTTCCCAGGAAGGAATTTGGTTGGATTCTGTCACTGTGGAGACCAAGATTTTTTAAAATTCCCAATTACAAAAGCA
GCATCACACTTGCTTCTGAGAACAGCAGGGTGATGTCTGTTCCCAAGCTGGTGGCGGGAGCCTTAGCCTGTGTGGGGCCACCCGGGGAAG
AGGAGGAGAGGAGGGTGAGGAGGCAGGCTCGCCGTTCCAAGGGACAGCATAGGCTCGTGGTGGGGCGTGTTGCATCTGGTGTCTGGGACA
GTCCCCGTCACCCCATGTGTGCGGCCTCTGCACTCCCAAGCTCCATGGCTGGGCTGGGCTGGGCTGGGCTGGGCTGGGCCGGGCGTGCGG
AGCCTGTGGAGCCAGCAGCTGCAGAGGCCTAGGAGGGAGTTCCTGGGGGAAGCGCACAGTGTCCAGTGCCCATCTCTTGCTTGTGTGTGA
GATTAGCCCTTGCTGGGGCGTCAAGAGGAAGAGCCTTAGACCTGGGCGGGCCTTCAGGGGCATCTAGACCCCTGCACAGCCCAGGCCTGG
TGTCTGCATTTCCACAGCACCCCTGTGGGGACTCCTGCCGGGGCTGGCCGCTGTCTCAGGAGAGACCCAATGGTTAGAAAGCCCCTTTTT
ACACAGCTGACAGCTTCTCCCAAGGCTTCCGTCCACGGGGACAGGCTTAACCCCTGGGCGCCTTTTCTGCAGCATGGCGGCCTTCTGAGT
CACCTAAGCTGAGCCTGGGTCATTCTCTGTGGCGGTCAGAAGGCCGATGGCCCCAACACAGTGGCTTGTGAAAGGGAGAGAGGAGGCTCT
GCATGTCCACCTGCTCTATGGGAGGAGGACACAGGTGTCCCCAGCCCAGCCTGTTCTCTCCCAGTCACTCAGGGATGGGGCCACCCAAAG
TGCAGGACCCGCCCCACCCTGCGGTTCGAAGCCTGGCCCCTGTCTCCACTTAGCTTCTGTTTCTGCAGTGGGTGGAAGCGAGTCAGCGGG
GGGCCTGGCTTGTGTACGTGTTTTCCTTATTTGGTCTGTGGGTTGCCAAGTCCATTTTTTTTTCCACTGAACTGGCTGGTAACTTGATGG
ACTGTGTAACTGACACAGGCCCTCTTTAGACCCCTGCCTTCACCCCACCCGCCCGGGTCCACTCCCTGGGGCGCTGTCCCAAGCCATCCC
TGCTTGCCAGCTCAAAGCTTCAGGTCCTAGGAGCCAGTCCACCTCGAAAGCCCTGAGAAAGTGAGACACCTGCACATTCGCTGGGGGAGA
CCCTCCGTTCTCTTGTGGCAGCTGCTCCCACTTGTTAAACCAAGCTGTTTCTGCGGGACGTGCTCACTCTTGGGAACCAGTGGCCTAGAG
CTTTGGGTTACAGGCATGGAGAGGGCTTTCCTGCCTCAGGCTTGGAGGCCAATGTTCCATACATAAACCGCCATGTCCTCTGGTGCAGCT
GGGCTGCTCTTTTAAAAGCCAGCATCCATCTTGAAGCTCGCTGGGTAAATGGCAATGCATTCTCAAGCCAGTGTCTTCAGCTGATGCCCA
GTGTCCAGTGCTGGTCACCAGTCCCCTTTGCTGGGTACAGCCTGCCTGGCTGTTCTGTGGTCCTGGAACGCTGCAGTGTGGTTTTGTTCC
ATGGAGACAGTACCAAGCGGAGAGGCCTCCTTGCCCACGGCCCCAGGGCCTGGGGGCCAGGGGTTCTGGCCCTGCGGGGACTTAGGCAGG
AGGGGAAGAGAAGCCCATGGAGCCATGGGAGGGGTGAGCTGTGGGCGGGGCCTAGTCATGGGAGGGGTGAGCTGTGGGCGGGGCGAGCTG
TGGGTGGGGCCTAGCCATGGGAGAGGTGAGCTGTGAATGGGGCTAGCTATGGGTGGGGTGAGCTGTGGACAGGGCCTAGCCATGGGAAAG
GTGAGCTGTGGGCGGGGCCTAGTCACGGGAGAGGTGAGCTGTGGGCGGGGCCTAGTCATGGGAGGGGTGAGCTGTGGATGGGGCCTAGCC
ATGGGAGGGGTGAGCTGTGAGTGGGGCTGAGCCATGGGAGCAGCAAGCTGGTGGAGTGGGCTGGGCGGAGCTGTGGGGGCTGCTGGCAGG
GCCTAGGAAAGTAGACAACTCCCGGGGGAGACGAAGTAGAGAGTGAGTCCCCAAGAAAGGGACTCCTGCCCCAGCGTCAAGTGCCAAAGC
AGGCCCCATCTACCACTTCAGGGTCGACGTTGGTGGCAGGTGTTGTTCACGGTGTACTGATTGTCACTGCAACACCTCCACATCACCTTG
AACTTCAAGAACAGCAGCAAAGCTGTATCTGCTATCAGAGGCTGTTAGGTAGTCCAGCTTTAAAATAACACACTCTTTCTCTATCCCATG
CCCTTTAAACAAGCAGCCACAGGAGATGTCAGTCTCCAGGGCCTGGCCCCACTGTGTTGACAGCAGTCACGTCTGTTGAGCTGACACTGC
TGAGGCTGAAGCTGGCCCCGTGCAGGTGGCTGGTGAGCCACAGGTGCAGTACCCGGAGGTGTGCTCTCCCCTAGAGGCCTGTCCCCAACT
CCTCCCCTAGAGGCCTATTCCCGCTGCTCACAGACCTCAGCAGAGGCACCAGCTGGAGGGCTCCAGGGACATCCTTGGAGATACAGGAGG
CTTTCCTGGCACAGGGCACAGCTCTTAGGAGGCCTTTGTAGGACGCTGTCTCCCCAGCGTGTCCTGCTCATCCAGGATGGGGAGAAAGAG
GAGGAGGCCCCAGGCTCAGAAGCCAGGGACAGACTGCCGACGATTACCAAACTGAATCCAGGCAGTGCCATGACCCTGGGTGTCCCTTGG
TTCACATCACCCACCAGACAGCTGCGGAGAGAGTGCAGGGAGGGGCTGGGACCAAACAGGCCAGAAACCAGCAGAAAAGAGGCAGAAGTG
AGGTGGGTGTGCCTGGGGCACGAAGCCAGCGCCGGGGGGATTTCAGTGGAGCCTTACAGCCAGGCTCCGTGCGGACTGTGATGCCAGAGA
GGCGTGCAGCCTCTGGGCAAGTCGGGAGAGGGCTTGGGTGGTCCCCACAAGGCAGAAGAGGTGGAAGGGCCAGAGAAGACCACCAAGACC
ACCGTTCCCGCAGGCCTGGGGTGAGTGACCTGACTGAGACTAGCGGGCAGAGCCAAGCAGGGCTAAACTCCAACCCAGGGCCCGGTGTTG
GACAAAGTAGCTTTTTCTTTGCTCGTTTGTCTGTGTATTAAGAAGAGACTAAAATAGCCAAACGACGCTGGTCGCATGCGCTGGCTGTGG
TCTGTCTGCTGAATGTCTATTTTTGTCTCCTGACGAGACGTGAGGACCATGCCCTTGATCCCTCCGATGGACCAGAAACCCCCTTCCTTG
CAAAAAAAAGGCAATTGAATTAGGAAAAGATAGCCCAACCTAGCTCAGATCCACCAAGATAAGCACAGCAAAGCTTGGCTGCATTTTTGA
GGAATAAAAACCTGCAGAAAGCACCGATAACCTTCAAGATCTGAATGAGATTCTATTATAACCCGTCTAAACGATTGCAAAATTCCTCCT
TTGGTTTTGGAAGCAGCGTTTGCTCTCCCGTGGCTCGGATTCTCTGAGGACCAGGGAGTTGACACACAAACCCCGCCATGGGTCCGAGCC
AGCTATTTCTCAAGGCTCCCACCTCGCCAAGCTCCCAAGGGCCTGCTGGCAGTGCCTACGCTGTGCCAACTACCCTGTCTGGTACAGACC
ACGGCTGGGTAAGCACCCTTAAAAGCAACAGAAATGACGTCTGGAAGCTGAAATGTGAAACTGTCAAGATGGCTTAGGAGAGGAAGGAGT
GGACCCGCTGGTCTTTGGCATTTTGTATTTAGAATTATTCTAACTTTATACATAATGTATAGGCCGATCTTTTGGAAGGGATAAGGTTTT

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000438376_chr7_2641075_+_1618nt
CCGGGGGGTCAGGGTCCCAGATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTA
TCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTT
CCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCA
CCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGC
TGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGC
ACCTGCTCCAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCA
GCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCC
TGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGC
AAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATC
ACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCC
CAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCC
CTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGC
TTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAATAAAAGGTAGTAATTAGAACAAAAAAAAAGGCTGTTCTGGATGAGGCGGCTGT
GGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAAGCACATGGCTCAGAGCCACCCAGCGTGCCAGG
CCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACGGGCAGCCCTGTGCAGGAGGAGGCCATCGTCAT
CATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAAAGAACCACCACCGCAGCTTCTACCAGGAGGAG
ATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCTGACCCCTCTCCCTCAGGGCCACAGGCCTTGGC

>In-frame_CD74_ENST00000377795_chr5_149781200_-_IQCE_ENST00000325979_chr7_2641075_+_1618nt
CCGGGGGGTCAGGGTCCCAGATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTA
TCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTT
CCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCA
CCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGC
TGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGC
ACCTGCTCCAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGAGAGCA
GCAGAGGCGGTCTTCAACATCCTGCCAGCCCCACACAGCTACAGCTTTCTTGCTCCCTTCAGCCCCCAGCCCCTCCCCCATCTCCCACCC
TGTACCTCATCCCATGAGACCCTGGTGCCTGGCTCTTTCGTCACCCTTGGACAAGACAAACCAAGTCGGAACAGCAGATAACAATGCAGC
AAGGCCCTGCTGCCCAATCTCCATCTGTCAACAGGGGCGTGAGGTCCCAGGAAGTGGCCAAAAGCTAGACAGATCCCCGTTCCTGACATC
ACAGCAGCCTCCAACACAAGGCTCCAAGACCTAGGCTCATGGACGAGATGGGAAGGCACAGGGAGAAGGGATAACCCTACACCCAGACCC
CAGGCTGGACATGCTGACTGTCCTCTCCCCTCCAGCCTTTGGCCTTGGCTTTTCTAGCCTATTTACCTGCAGGCTGAGCCACTCTCTTCC
CTTTCCCCAGCATCACTCCCCAAGGAAGAGCCAATGTTTTCCACCCATAATCCTTTCTGCCGACCCCTAGTTCCCTCTGCTCAGCCAAGC
TTGTTATCAGCTTTCAGGGCCATGGTTCACATTAGAATAAAAGGTAGTAATTAGAACAAAAAAAAAGGCTGTTCTGGATGAGGCGGCTGT
GGTGCTTCAGGCAGCTTTCAGGGGACATCTCACGCGGACAAAGCTCTTAGCAAGCAAAGCACATGGCTCAGAGCCACCCAGCGTGCCAGG
CCTCCCAGACCAGAGCTCTCCTGTGCCCCGCGTTCCGAGCCCCATCGCCCAGGCCACGGGCAGCCCTGTGCAGGAGGAGGCCATCGTCAT
CATCCAGTCCGCTCTGCGGGCACACCTGGCCCGGGCCAGGCACAGTGCTACCGGTAAAAGAACCACCACCGCAGCTTCTACCAGGAGGAG
ATCGGCTTCAGCCACACACGGGGACGCCTCCTCCCCACCCTTCCTCGCAGCTCTTCCTGACCCCTCTCCCTCAGGGCCACAGGCCTTGGC


Top

FusionGenePPI for CD74_IQCE


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CD74MIF, CD74, APP, HADHA, LAMTOR5, MAP3K1, TM4SF20, COPG1, COPG2, HLA-DPB1, HLA-DQA1, CD44IQCECARD9, CEP70, GOLGA2, HOOK2, LZTS2, MTUS2, RPGRIP1, SPAG5, TRIM23, TRIM27, TTC23L, PSMA3, CALM2, CALM3, RFFL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CD74_IQCE


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CD74_IQCE


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCD74C0007131Non-Small Cell Lung Carcinoma1CTD_human
HgeneCD74C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneCD74C0162557Liver Failure, Acute1CTD_human
HgeneCD74C1458155Mammary Neoplasms1CTD_human