FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6127

FusionGeneSummary for CD109_NPHP1

check button Fusion gene summary
Fusion gene informationFusion gene name: CD109_NPHP1
Fusion gene ID: 6127
HgeneTgene
Gene symbol

CD109

NPHP1

Gene ID

135228

4867

Gene nameCD109 moleculenephrocystin 1
SynonymsCPAMD7|p180|r150JBTS4|NPH1|SLSN1
Cytomap

6q13

2q13

Type of geneprotein-codingprotein-coding
DescriptionCD109 antigen150 kDa TGF-beta-1-binding proteinC3 and PZP-like alpha-2-macroglobulin domain-containing protein 7Gov platelet alloantigensactivated T-cell marker CD109platelet-specific Gov antigennephrocystin-1juvenile nephronophthisis 1 proteinnephronophthisis 1 (juvenile)
Modification date2018052220180519
UniProtAcc

Q6YHK3

O15259

Ensembl transtripts involved in fusion geneENST00000422508, ENST00000437994, 
ENST00000287097, ENST00000474094, 
ENST00000316534, ENST00000445609, 
ENST00000393272, ENST00000355301, 
ENST00000417665, ENST00000418527, 
Fusion gene scores* DoF score3 X 3 X 2=182 X 2 X 2=8
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: CD109 [Title/Abstract] AND NPHP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCD109

GO:0030512

negative regulation of transforming growth factor beta receptor signaling pathway

16754747

HgeneCD109

GO:0061045

negative regulation of wound healing

16754747


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1W33075CD109chr6

74440297

+NPHP1chr2

110920711

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000422508ENST00000316534CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000422508ENST00000445609CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000422508ENST00000393272CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000422508ENST00000355301CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000422508ENST00000417665CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-intronENST00000422508ENST00000418527CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000437994ENST00000316534CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000437994ENST00000445609CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000437994ENST00000393272CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000437994ENST00000355301CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000437994ENST00000417665CD109chr6

74440297

+NPHP1chr2

110920711

-
5CDS-intronENST00000437994ENST00000418527CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000287097ENST00000316534CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000287097ENST00000445609CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000287097ENST00000393272CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000287097ENST00000355301CD109chr6

74440297

+NPHP1chr2

110920711

-
In-frameENST00000287097ENST00000417665CD109chr6

74440297

+NPHP1chr2

110920711

-
5CDS-intronENST00000287097ENST00000418527CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000474094ENST00000316534CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000474094ENST00000445609CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000474094ENST00000393272CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000474094ENST00000355301CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-3CDSENST00000474094ENST00000417665CD109chr6

74440297

+NPHP1chr2

110920711

-
intron-intronENST00000474094ENST00000418527CD109chr6

74440297

+NPHP1chr2

110920711

-

Top

FusionProtFeatures for CD109_NPHP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CD109

Q6YHK3

NPHP1

O15259

Together with BCAR1 it may play a role in the control ofepithelial cell polarity. Involved in the organization of apicaljunctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8(By similarity). Does not seem to be strictly required forciliogenesis (By similarity). Seems to help to recruit PTK2B/PYK2to cell matrix adhesions, thereby initiating phosphorylation ofPTK2B/PYK2 and PTK2B/PYK2-dependent signaling. May play a role inthe regulation of intraflagellar transport (IFT) during ciliaassembly. Required for normal retina development. In connectingphotoreceptor cilia influences the movement of some IFT proteinssuch as IFT88 and WDR19. Involved in spermatogenesis (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CD109_NPHP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_590aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKQINTVDVLTTM
GAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFD
GNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPI
PAKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLL
KDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETAR

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_590aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKQINTVDVLTTM
GAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFD
GNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPI
PAKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLL
KDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETAR

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_589aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETARW

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_589aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETARW

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_624aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKLSKPVSPREGKKKWPELYHILKTMHCSCLPCTKIMRDKEFLK

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_590aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKQINTVDVLTTM
GAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFD
GNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPI
PAKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLL
KDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETAR

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_590aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKQINTVDVLTTM
GAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFD
GNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPI
PAKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLL
KDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETAR

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_589aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETARW

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_589aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFRWAEEETETARW

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_624aa
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVSVLEAEGVFEKGSFKTLTL
PSLPLNSADEITELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKINTVDVLTTMG
AIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDG
NKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISTIRNSTGERGELSCGWVFLKLFDASGVPIP
AKTTELFLNGGTPTEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFTRQILGDVLLK
DRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKLSKPVSPREGKKKWPELYHILKTMHCSCLPCTKIMRDKEFLK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_1770nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATG
GGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCA
GAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTG
ATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGAT
GGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACT
CGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATT
TCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATT
CCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACAC
GGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTA
CTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTG
AAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATG
GATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTC
CTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGG
TGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_1770nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATG
GGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCA
GAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTG
ATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGAT
GGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACT
CGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATT
TCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATT
CCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACAC
GGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTA
CTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTG
AAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATG
GATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTC
CTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGG
TGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_1767nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTG
GTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGG
AAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_1767nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTG
GTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGG
AAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_1872nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGCTCTCAAAGCCTGTATCACCAAGAGAAGGGAAAAAA
AAATGGCCTGAGCTGTACCATATATTGAAAACAATGCATTGCTCCTGCTTACCTTGCTATAAAATCATGAGAGACAAAGAGTTCCTGAAG
TCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACT
GAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGA

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_1770nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATG
GGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCA
GAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTG
ATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGAT
GGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACT
CGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATT
TCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATT
CCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACAC
GGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTA
CTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTG
AAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATG
GATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTC
CTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGG
TGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCT

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_1770nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATG
GGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCA
GAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTG
ATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGAT
GGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACT
CGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATT
TCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATT
CCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACAC
GGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTA
CTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTG
AAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATG
GATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTC
CTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGG
TGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCT

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_1767nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTG
GTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGG
AAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTT

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_1767nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTG
GTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGG
AAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTT

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_1872nt
ATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTG
ACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCG
GAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTT
CCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACC
CGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATT
GTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGA
GCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAG
CTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATT
CTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGT
AATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGC
ATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCT
TATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCA
GCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGC
AGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTA
AGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAA
GACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGAT
GCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGCTCTCAAAGCCTGTATCACCAAGAGAAGGGAAAAAA
AAATGGCCTGAGCTGTACCATATATTGAAAACAATGCATTGCTCCTGCTTACCTTGCTATAAAATCATGAGAGACAAAGAGTTCCTGAAG
TCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACT
GAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_3681nt
ATAGTTGCTATGAATTTCTCCTCACAAGGATGGGCCTGTTTACTCACCCTGGGCATCGTTGGTAGAGCGCTAGTGTAAACAGCCTGAGGA
ACCCGGTGGGCCGGGGAAGTGGGCGCGCTCTGTTCTCCGCGGCCAGCTGGGACGCCGGGCCAGGTGGGGCCGCCTGCGTTTAGCAACTGC
TTTCTCACCCCCTGGATTTGCGATGTTTGCCACAGCAGCGAGAAGCGCCATTGTAATGGGGATGGGAGGGGTGGAGCCTCCAAGTCCTGT
CTCAATTTAGATCTCTCACTCTGCTGTTAGGCGCGCCCATTTCAGATTACTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGT
GGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGTAGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCC
TGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCA
GGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCAT
CAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACA
GTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCA
AGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATT
TTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGT
TCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAAC
TGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCT
GTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCA
ACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGC
TTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAA
CTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGC
TTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGA
TTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAA
CATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGC
AAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGT
GGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCG
TGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACT
TCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGA
CCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTC
CACGATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTACAACTTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTT
AAAGAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATAAATTTTTATAAGGAATACTGTTATATCTAAATTTAAACAGT
ATTTATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTATAAAAGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCA
AGAAAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATCATCTAACTGATAAAGGTCTAGTATCCAAAATATTTAAATTT
ATGAGTGTTAATAAAATTTATCTTGTTCAATGAAGAGGAAGTTAAAGTGATCCATTTGAGAAAGTTGTATCACTTAATTCAGTCTGATAC
TTGAATGTGATTTACCCCTAATTAAGTACAAAAACAGAGTCGCTTTTGCCTTTTCAAATCAAGAAAATAAGTGCTCTGTCAAAAGCACAA
AAAGAAACTTTCAGGCACTGGAGAGTGGAGTCGACTCACCCTTTCAGGCCTTGTTGCATCTCAGATAAACCTGTGACTGCTGGTAAAATA
ATGTCCCAAGCCTTTCCTTTTAGTGATAAACAGTAGCAGCCTGCGTTAATTGAGCACCTACTGTGTGTCTGAGCATTTCTCATTAGCCCA
GTTAATCCTCACACCTACTGTAGGAGATAGGTACTGTTGTTTTTTATTACCGCCGAAGAAACAGGCCAGATAAGTGAAGTAATTTGCCTA
AGGTCACAGCTAATAAGTGGCACAGCTAATATTCCCAGTAAAGATACCATGTATAATTTTCTACAACCTAAGATGTTCTGCCTTATCGGG
GCGAACCTTTTAGGATTCCATGTGAAAATAAAATATGAGGAAAAGTTTAACCTAAATAATTAGAATCCCATTAGAGGTACTTTTTTTTGA
TGGCATGCTGCCTTAAAAGAGCCATTTATTTTTAGAGATCTGTCATATTATGAAAGTTCTGGGCTATCTTAGCTAACTTATCCTAAACCC
TTAACCTAAATTTAACTTGAGCCCCAGTCTCAGAAATTAACATGGTATGAAGGTGTTTCCAGGCCAGGCGCGGTGGCTCACGCCTGTAAT
CCCAACACTTTGGGAGGCCGAGGTGGGTGGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACACTATCTGTACTAAAAACACA
AAATTAGCTGGGCGTGGTAGTGCGTGCCTGTAATCCCAGCTACTTGGGAGGCTGAGGTAGAAGAATTGTTTGAACCTGGGAGGTGGAGGT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_2656nt
ATAGTTGCTATGAATTTCTCCTCACAAGGATGGGCCTGTTTACTCACCCTGGGCATCGTTGGTAGAGCGCTAGTGTAAACAGCCTGAGGA
ACCCGGTGGGCCGGGGAAGTGGGCGCGCTCTGTTCTCCGCGGCCAGCTGGGACGCCGGGCCAGGTGGGGCCGCCTGCGTTTAGCAACTGC
TTTCTCACCCCCTGGATTTGCGATGTTTGCCACAGCAGCGAGAAGCGCCATTGTAATGGGGATGGGAGGGGTGGAGCCTCCAAGTCCTGT
CTCAATTTAGATCTCTCACTCTGCTGTTAGGCGCGCCCATTTCAGATTACTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGT
GGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGTAGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCC
TGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCA
GGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCAT
CAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACA
GTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCA
AGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATT
TTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACACTGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGT
TCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAAC
TGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCT
GTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCA
ACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGC
TTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAA
CTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGC
TTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGA
TTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAA
CATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGC
AAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGT
GGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCG
TGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACT
TCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGA
CCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTC
CACGATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTACAACTTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTT
AAAGAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATAAATTTTTATAAGGAATACTGTTATATCTAAATTTAAACAGT
ATTTATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTATAAAAGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCA
AGAAAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATCATCTAACTGATAAAGGTCTAGTATCCAAAATATTTAAATTT

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_2653nt
ATAGTTGCTATGAATTTCTCCTCACAAGGATGGGCCTGTTTACTCACCCTGGGCATCGTTGGTAGAGCGCTAGTGTAAACAGCCTGAGGA
ACCCGGTGGGCCGGGGAAGTGGGCGCGCTCTGTTCTCCGCGGCCAGCTGGGACGCCGGGCCAGGTGGGGCCGCCTGCGTTTAGCAACTGC
TTTCTCACCCCCTGGATTTGCGATGTTTGCCACAGCAGCGAGAAGCGCCATTGTAATGGGGATGGGAGGGGTGGAGCCTCCAAGTCCTGT
CTCAATTTAGATCTCTCACTCTGCTGTTAGGCGCGCCCATTTCAGATTACTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGT
GGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGTAGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCC
TGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCA
GGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCAT
CAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACA
GTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCA
AGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATT
TTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCA
GGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGG
CCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTA
AAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACA
TTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTG
ATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTG
GTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTT
TCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTA
TGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACAT
TAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAA
GTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGG
CTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGC
TCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCC
TTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCT
ATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTCCAC
GATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTACAACTTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTTAAA
GAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATAAATTTTTATAAGGAATACTGTTATATCTAAATTTAAACAGTATT
TATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTATAAAAGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCAAGA
AAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATCATCTAACTGATAAAGGTCTAGTATCCAAAATATTTAAATTTATG

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_2281nt
ATAGTTGCTATGAATTTCTCCTCACAAGGATGGGCCTGTTTACTCACCCTGGGCATCGTTGGTAGAGCGCTAGTGTAAACAGCCTGAGGA
ACCCGGTGGGCCGGGGAAGTGGGCGCGCTCTGTTCTCCGCGGCCAGCTGGGACGCCGGGCCAGGTGGGGCCGCCTGCGTTTAGCAACTGC
TTTCTCACCCCCTGGATTTGCGATGTTTGCCACAGCAGCGAGAAGCGCCATTGTAATGGGGATGGGAGGGGTGGAGCCTCCAAGTCCTGT
CTCAATTTAGATCTCTCACTCTGCTGTTAGGCGCGCCCATTTCAGATTACTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGT
GGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGTAGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCC
TGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCA
GGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCAT
CAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACA
GTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCA
AGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATT
TTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCA
GGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGG
CCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTA
AAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACA
TTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTG
ATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTG
GTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTT
TCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTA
TGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACAT
TAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAA
GTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGG
CTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGC
TCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCC
TTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCT
ATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTCCAC

>In-frame_CD109_ENST00000437994_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_2386nt
ATAGTTGCTATGAATTTCTCCTCACAAGGATGGGCCTGTTTACTCACCCTGGGCATCGTTGGTAGAGCGCTAGTGTAAACAGCCTGAGGA
ACCCGGTGGGCCGGGGAAGTGGGCGCGCTCTGTTCTCCGCGGCCAGCTGGGACGCCGGGCCAGGTGGGGCCGCCTGCGTTTAGCAACTGC
TTTCTCACCCCCTGGATTTGCGATGTTTGCCACAGCAGCGAGAAGCGCCATTGTAATGGGGATGGGAGGGGTGGAGCCTCCAAGTCCTGT
CTCAATTTAGATCTCTCACTCTGCTGTTAGGCGCGCCCATTTCAGATTACTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGT
GGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGTAGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCC
TGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGCTCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCA
GGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCCTTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCAT
CAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGGCTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACA
GTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGAGATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCA
AGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAAGCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATT
TTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCA
GGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGG
CCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTA
AAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACA
TTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTG
ATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTG
GTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTT
TCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTA
TGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACAT
TAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAA
GTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGG
CTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGCTCTCAAAGCCTGTATCACCAAGAGAAGGGAAAAAAAAATGGCCTGAGCTGTACC
ATATATTGAAAACAATGCATTGCTCCTGCTTACCTTGCTATAAAATCATGAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTT
ACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAG
TTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACC
TTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCCTCTAGCCCTCAGCTTCCCACGGAATC

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000316534_chr2_110920711_-_3362nt
CTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGTGGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGT
AGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGC
TCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCC
TTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGG
CTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGA
GATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAA
GCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACAC
TGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCG
AGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTC
GAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACA
TGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATG
GACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGG
AATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTT
TGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCC
TTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTT
GAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACA
AATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCT
CTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGA
GTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGA
AGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTC
ACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCA
GCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTCCACGATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTAC
AACTTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTTAAAGAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATA
AATTTTTATAAGGAATACTGTTATATCTAAATTTAAACAGTATTTATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTAT
AAAAGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCAAGAAAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATC
ATCTAACTGATAAAGGTCTAGTATCCAAAATATTTAAATTTATGAGTGTTAATAAAATTTATCTTGTTCAATGAAGAGGAAGTTAAAGTG
ATCCATTTGAGAAAGTTGTATCACTTAATTCAGTCTGATACTTGAATGTGATTTACCCCTAATTAAGTACAAAAACAGAGTCGCTTTTGC
CTTTTCAAATCAAGAAAATAAGTGCTCTGTCAAAAGCACAAAAAGAAACTTTCAGGCACTGGAGAGTGGAGTCGACTCACCCTTTCAGGC
CTTGTTGCATCTCAGATAAACCTGTGACTGCTGGTAAAATAATGTCCCAAGCCTTTCCTTTTAGTGATAAACAGTAGCAGCCTGCGTTAA
TTGAGCACCTACTGTGTGTCTGAGCATTTCTCATTAGCCCAGTTAATCCTCACACCTACTGTAGGAGATAGGTACTGTTGTTTTTTATTA
CCGCCGAAGAAACAGGCCAGATAAGTGAAGTAATTTGCCTAAGGTCACAGCTAATAAGTGGCACAGCTAATATTCCCAGTAAAGATACCA
TGTATAATTTTCTACAACCTAAGATGTTCTGCCTTATCGGGGCGAACCTTTTAGGATTCCATGTGAAAATAAAATATGAGGAAAAGTTTA
ACCTAAATAATTAGAATCCCATTAGAGGTACTTTTTTTTGATGGCATGCTGCCTTAAAAGAGCCATTTATTTTTAGAGATCTGTCATATT
ATGAAAGTTCTGGGCTATCTTAGCTAACTTATCCTAAACCCTTAACCTAAATTTAACTTGAGCCCCAGTCTCAGAAATTAACATGGTATG
AAGGTGTTTCCAGGCCAGGCGCGGTGGCTCACGCCTGTAATCCCAACACTTTGGGAGGCCGAGGTGGGTGGATCACCTGAGGTCAGGAGT
TTGAGACCAGCCTGGCCAACACTATCTGTACTAAAAACACAAAATTAGCTGGGCGTGGTAGTGCGTGCCTGTAATCCCAGCTACTTGGGA
GGCTGAGGTAGAAGAATTGTTTGAACCTGGGAGGTGGAGGTTGCAGTGAGCCAAGATCGTGCCATTGCACTCCAGCCTAGGCAACAAGAG

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000445609_chr2_110920711_-_2337nt
CTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGTGGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGT
AGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGC
TCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCC
TTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGG
CTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGA
GATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAA
GCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGCAGATAAACAC
TGTTGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCG
AGCAAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTC
GAGACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACA
TGTACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATG
GACCTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGG
AATATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTT
TGATGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCC
TTCAATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTT
GAACAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACA
AATTCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCT
CTTGGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGA
GTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGA
AGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTC
ACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCA
GCCTCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTCCACGATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTAC
AACTTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTTAAAGAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATA
AATTTTTATAAGGAATACTGTTATATCTAAATTTAAACAGTATTTATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTAT
AAAAGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCAAGAAAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATC

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000393272_chr2_110920711_-_2334nt
CTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGTGGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGT
AGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGC
TCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCC
TTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGG
CTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGA
GATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAA
GCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGT
TGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGC
AAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAG
ACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGT
ACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGAC
CTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAAT
ATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGA
TGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTC
AATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAA
CAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAAT
TCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTT
GGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTT
CCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGA
AGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACC
AGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCC
TCTAGCCCTCAGCTTCCCACGGAATCAGATGGATCCTCCACGATTACGTGAATAAAATGATGGAACCAAAAATCACTGTCACTTTACAAC
TTAGGTTTTACTCTTTTCTTTCTACAGACCATATTTTTAAAGAAATGTTTATACAATAATTTAAATATTTTTTAAAACCATAAAATAAAT
TTTTATAAGGAATACTGTTATATCTAAATTTAAACAGTATTTATTTTTTCAAAAACAGCTACTTAAGTTAATGGTATAGATTTCTATAAA
AGCAAGATTTTGTCAAAAACTAAATTTATGATTATTCAAGAAAGTGAAAAAAACAACCTACAGAATGGGAAAACATATTTGCAAATCATC

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000355301_chr2_110920711_-_1962nt
CTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGTGGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGT
AGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGC
TCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCC
TTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGG
CTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGA
GATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAA
GCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGT
TGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGC
AAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAG
ACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGT
ACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGAC
CTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAAT
ATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGA
TGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTC
AATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAA
CAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAAT
TCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTT
GGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGAGAGACAAAGAGTT
CCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATTCAGGTGGGCAGAAGA
AGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCAAGCTCTGCTGTCACC
AGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGTGTGACAGTGGCAGCC

>In-frame_CD109_ENST00000287097_chr6_74440297_+_NPHP1_ENST00000417665_chr2_110920711_-_2067nt
CTAAACTCGAATTAAGAGGGAAAAAAAATCAGGGAGGAGGTGGCAAGCCACACCCCACGGTGCCCGCGAACTTCCCCGGCAGCGGACTGT
AGCCCAGGCAGACGCCGTCGAGATGCAGGGCCCACCGCTCCTGACCGCCGCCCACCTCCTCTGCGTGTGCACCGCCGCGCTGGCCGTGGC
TCCCGGGCCTCGGTTTCTGGTGACAGCCCCAGGGATCATCAGGCCCGGAGGAAATGTGACTATTGGGGTGGAGCTTCTGGAACACTGCCC
TTCACAGGTGACTGTGAAGGCGGAGCTGCTCAAGACAGCATCAAACCTCACTGTCTCTGTCCTGGAAGCAGAAGGAGTCTTTGAAAAAGG
CTCTTTTAAGACACTTACTCTTCCATCACTACCTCTGAACAGTGCAGATGAGATTTATGAGCTACGTGTAACCGGACGTACCCAGGATGA
GATTTTATTCTCTAATAGTACCCGCTTATCATTTGAGACCAAGAGAATATCTGTCTTCATTCAAACAGACAAGGCCTTATACAAGCCAAA
GCAAGAAGTGAAGTTTCGCATTGTTACACTCTTCTCAGATTTTAAGCCTTACAAAACCTCTTTAAACATTCTCATTAAGATAAACACTGT
TGATGTGTTAACTACGATGGGAGCTATTCCTGCAGGGTTCAGGCCTTCCACGCTCTCACAGCTTCTGGAGGAAGGGAATCAATTTCGAGC
AAATTACTTCTTACAACCAGAGCTCATGCCTTCACAACTGGCCTTCAGAGATCTGATGTGGGATGCTACAGAAGGCACTATTAGGTCGAG
ACCAAGTCGTATTTCATTGATTCTGACATTATGGAGCTGTAAAATGATTCCTCTTCCAGGAATGAGCATACAGGTTCTCAGCAGACATGT
ACGCCTCTGTCTATTTGATGGTAATAAGGTTCTGAGCAACATTCATACAGTCAGAGCCACATGGCAACCTAAAAAGCCCAAAACATGGAC
CTTTTCTCCCCAGGTTACTCGCATCTTACCATGTTTGCTTGATGGTGATTGCTTTATCAGGTCTAATTCTGCATCTCCAGATCTTGGAAT
ATTATTTGAACTTGGAATTTCTTATATTCGCAATTCAACTGGTGAAAGAGGAGAGTTAAGCTGTGGCTGGGTGTTTCTTAAACTTTTTGA
TGCCAGTGGAGTTCCTATTCCAGCAAAAACTTATGAGCTTTTCTTGAATGGTGGTACTCCTTATGAAAAAGGTATTGAAGTGGACCCTTC
AATATCCAGAAGAGCACACGGCAGTGTTTTCTACCAGATTATGACAATGAGAAGGCAGCCTCAACTTCTAGTGAAACTGAGATCCTTGAA
CAGAAGATCAAGAAATGTACTAAGTCTACTGCCAGAAACATTAATTGGAAATATGTGTTCTATTCACTTGTTGATATTTTATCGACAAAT
TCTTGGAGATGTGCTCCTGAAAGACAGGATGAGCTTGCAAAGTACTGATTTAATTAGCCATCCCATGCTGGCCACCTTCCCCATGCTCTT
GGAGCAGCCTGATGTGATGGATGCTCTCAGGAGTTCGTGGGCTGGAAAAGAAAGCACATTAAAAAGATCAGAGAAGCTCTCAAAGCCTGT
ATCACCAAGAGAAGGGAAAAAAAAATGGCCTGAGCTGTACCATATATTGAAAACAATGCATTGCTCCTGCTTACCTTGCTATAAAATCAT
GAGAGACAAAGAGTTCCTGAAGTCCACGTTTCTCCTGGTTTACCATGACTGCGTGCTCCCACTTCTCCACTCCACACGCCTACCCCCATT
CAGGTGGGCAGAAGAAGAGACTGAGACTGCACGGTGGAAAGTTATCACTGACTTCCTTAAGCAAAACCAAGAAAACCAGGGCGCCCTCCA
AGCTCTGCTGTCACCAGACGGAGTTCATGAACCTTTTGACCTTTCAGAGCAGACCTATGACTTCTTGGGTGAAATGAGAAAGAATGCAGT


Top

FusionGenePPI for CD109_NPHP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CD109FCGR3B, LGALS3, TAZ, CELA2B, LGALS9, TMEM185A, PTPRK, ISLR, ERLIN2, RNASE13, MYH9, SYNPO, MAPRE1, MYO5C, CAPN1, SCGB1D1, CYP19A1, SCGB1D4, IFNA21, PRSS33, ENPP7, IFNE, PRSS37, GJB7, MTUS2, CCL22, DKKL1, C4orf26, DEFA5, ST8SIA4, PCDHGC3, TRIM25NPHP1INVS, TUBB, NPHP3, NPHP1, FLNA, FLNB, BCAR1, NPHP4, PTK2B, TNS1, KHDRBS1, TNK2, ARHGAP32, UBQLN4, ADAM15, MED28, CEP164, CEP128, AGK, ATP2B1, BAIAP2L1, BCAS3, TMEM256, CACYBP, CBL, CEP170, CHTOP, CLTC, COPA, DBT, DNM2, DNMBP, DYNC1H1, ECD, FCHO2, FKBP4, GARS, GPATCH1, HK1, HSDL2, HYOU1, IDH3B, IQGAP1, KDELR2, MOB4, NARS, NDUFS3, NDUFV1, NNT, NUDCD3, PDRG1, PHACTR4, PIH1D1, POLR2E, PRRC2A, PSMD14, PSMD7, RAB35, RAB3GAP1, RAB6A, RPAP3, RPGRIP1L, SEC23IP, SEC63, SH3D19, SNX9, SRSF2, TM9SF3, TMEM237, TNRC6B, TTLL12, UNC45A, UQCRC1, URI1, USP22, UXT, WDR41, WDR92, XPO7, BAG2, FLII, WDR83, KCNA5, DNAJC7, RPGR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CD109_NPHP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CD109_NPHP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCD109C0009404Colorectal Neoplasms2CTD_human
HgeneCD109C1458155Mammary Neoplasms1CTD_human
TgeneNPHP1C0022658Kidney Diseases1CTD_human;HPO
TgeneNPHP1C1855681Nephronophthisis, familial juvenile1CTD_human;ORPHANET;UNIPROT