FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6070

FusionGeneSummary for CCSER1_SPARCL1

check button Fusion gene summary
Fusion gene informationFusion gene name: CCSER1_SPARCL1
Fusion gene ID: 6070
HgeneTgene
Gene symbol

CCSER1

SPARCL1

Gene ID

401145

8404

Gene namecoiled-coil serine rich protein 1SPARC like 1
SynonymsFAM190AMAST 9|MAST9|PIG33|SC1
Cytomap

4q22.1

4q22.1

Type of geneprotein-codingprotein-coding
Descriptionserine-rich coiled-coil domain-containing protein 1family with sequence similarity 190, member Aprotein FAM190ASPARC-like protein 1SPARC-like 1 (hevin)high endothelial venule proteinproliferation-inducing protein 33
Modification date2018051920180523
UniProtAcc

Q9C0I3

Q14515

Ensembl transtripts involved in fusion geneENST00000509176, ENST00000333691, 
ENST00000432775, ENST00000504150, 
ENST00000282470, ENST00000418378, 
ENST00000503414, 
Fusion gene scores* DoF score8 X 7 X 4=22410 X 8 X 5=400
# samples 811
** MAII scorelog2(8/224*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/400*10)=-1.86249647625006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CCSER1 [Title/Abstract] AND SPARCL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-AA68-01ACCSER1chr4

91389505

+SPARCL1chr4

88394955

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000509176ENST00000282470CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000509176ENST00000418378CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000509176ENST00000503414CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
Frame-shiftENST00000333691ENST00000282470CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000333691ENST00000418378CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000333691ENST00000503414CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
Frame-shiftENST00000432775ENST00000282470CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000432775ENST00000418378CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
In-frameENST00000432775ENST00000503414CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
intron-3CDSENST00000504150ENST00000282470CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
intron-3CDSENST00000504150ENST00000418378CCSER1chr4

91389505

+SPARCL1chr4

88394955

-
intron-3CDSENST00000504150ENST00000503414CCSER1chr4

91389505

+SPARCL1chr4

88394955

-

Top

FusionProtFeatures for CCSER1_SPARCL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CCSER1

Q9C0I3

SPARCL1

Q14515


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CCSER1_SPARCL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS

>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_584aa
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISFHHKKGSEPKQEPTNQNLSIS
NGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSE
MDAFSKSGSMASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIPTSGDHHIFNKTSHGYEANPAKVLASSLSPF
REGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT

>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_1753nt
ATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCT
TCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGG
AGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCA
AATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGT
AGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAAT
TGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTA
CTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCA
TTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGC
TCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAA
ATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCT
GCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGT
AGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTG
AGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCC
CCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCT
ACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTT
CGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGA
AATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGA
TCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCA
TATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_2468nt
GTCTCAACATGACTGACTGGGAAGCGGTGGCTCGGGCAGAGCAGCTCCGCTGGCGCAGGCAGGAGGAGCAGGAGGATTATTAAATAACGC
AGCTGGACTCTGTGCAACTGGGAGTGGAGAGGAGCCCAACAGCCGAGAAGGGGAGGGAGGGCAGAGGAGGGGGACCAGGAAGGACACCCC
CGTGCCCCGAAGACATAAATCCCTGAGTGCCCGGGAGGAGCCTTAACAAGCGCACGGAGCCCTCAAGGCTGCAAAGTTGGCTTTCACAGT
GCAAGCCTTTGATTCCCAATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGA
AGACATGATTCTCTTCCTTCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGT
AGCACAGGTAAACGGAGGAGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAAC
CAGAACCTTAGTATTTCAAATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGA
CATTCTGTTGGTTTTAGTAGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAAC
AAGAATGTCTTTATAAATTGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAG
CAGTCAACAAGGAAGCTACTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTA
CAACAGTCTGAATTCTCATTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTA
ACAGAACGGGCAGGAAGCTCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACT
GAAGATTCTGTGTCTGAAATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCT
CAGATGTCCCTCAATTCTGCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATAT
AGGTTAGAGGGTCAATGTAGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAA
CTACCTGCTACAAGTGTGAGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACA
ATGCTGGGGACAAACTCCCCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCA
GATTCAAAGATAATACCTACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCC
AGTAGTCTCAGTCCATTTCGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATT
TTGAAACCGAAAGATGGAAATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGAT
GTTTTGAATAATTTGGGATCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCT
GTTTGCCGGGAGGACTCATATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGA
GAAGAACCAGAATTTCCTGAGCCTTCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCA
GCATCCTCCTCTGTTCTAACCACTTCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAA
GACAATGAGAGTAATTGCTTGACAACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAA
CATATGCAAAATACTGTACATTGTGAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAA
CTATTAATGATAAAAATAATGCATTTGTATTGTTCATAATATCATGTGCACTTCAAGAAAATGGAATGCTACTCTTTTGTGGTTTACGTG

>In-frame_CCSER1_ENST00000509176_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_2398nt
GTCTCAACATGACTGACTGGGAAGCGGTGGCTCGGGCAGAGCAGCTCCGCTGGCGCAGGCAGGAGGAGCAGGAGGATTATTAAATAACGC
AGCTGGACTCTGTGCAACTGGGAGTGGAGAGGAGCCCAACAGCCGAGAAGGGGAGGGAGGGCAGAGGAGGGGGACCAGGAAGGACACCCC
CGTGCCCCGAAGACATAAATCCCTGAGTGCCCGGGAGGAGCCTTAACAAGCGCACGGAGCCCTCAAGGCTGCAAAGTTGGCTTTCACAGT
GCAAGCCTTTGATTCCCAATGGGGGACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGA
AGACATGATTCTCTTCCTTCTTCACCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGT
AGCACAGGTAAACGGAGGAGCATATTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAAC
CAGAACCTTAGTATTTCAAATGGTGCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGA
CATTCTGTTGGTTTTAGTAGTTCACGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAAC
AAGAATGTCTTTATAAATTGTCTAAGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAG
CAGTCAACAAGGAAGCTACTCCCTAAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTA
CAACAGTCTGAATTCTCATTGGAAGTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTA
ACAGAACGGGCAGGAAGCTCTTTACAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACT
GAAGATTCTGTGTCTGAAATGGATGCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCT
CAGATGTCCCTCAATTCTGCTGCTGTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATAT
AGGTTAGAGGGTCAATGTAGCACTGAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAA
CTACCTGCTACAAGTGTGAGCCACTCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACA
ATGCTGGGGACAAACTCCCCAAGGAAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCA
GATTCAAAGATAATACCTACTTCTGGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCC
AGTAGTCTCAGTCCATTTCGTGAAGGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATT
TTGAAACCGAAAGATGGAAATATAGAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGAT
GTTTTGAATAATTTGGGATCTTGTGAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCT
GTTTGCCGGGAGGACTCATATCACTCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGA
GAAGAACCAGAATTTCCTGAGCCTTCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCA
GCATCCTCCTCTGTTCTAACCACTTCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAA
GACAATGAGAGTAATTGCTTGACAACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAA
CATATGCAAAATACTGTACATTGTGAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAA

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_2534nt
GTTACCATCGAGACCGGGGCTGTGTATGCTCGAGGTGCAGGGAGCTAATGTATAAGGAGTTAAATGAACTCTTGCTGCTGCCAAATATGT
TGTTATCACTAACTGCACCGCTGCTGTCATTAGTGCTGCTGCCAACACTGCAAGCCCTGCTGCTGCCAGTGCCAATTCTGCTGATGCCTT
GGGCTCTCCATGTCCCAGGGTGATTCCATAGACAAGCAGCTGCTTTTAGATTTCACTTGCTCATTACCTGTAGATCCTTTGCCTTAGGAC
TCAAGCTTAAGCCCATGAAGCCTGGGATAGAAGACAATTGGAGGCTGCAAAGTTGGCTTTCACAGTGCAAGCCTTTGATTCCCAATGGGG
GACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCTTCTTCA
CCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGGAGCATA
TTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCAAATGGT
GCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGTAGTTCA
CGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAATTGTCTA
AGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTACTCCCT
AAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCATTGGAA
GTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGCTCTTTA
CAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAAATGGAT
GCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCTGCTGCT
GTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGTAGCACT
GAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTGAGCCAC
TCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCCCCAAGG
AAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCTACTTCT
GGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTTCGTGAA
GGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGAAATATA
GAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGATCTTGT
GAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCATATCAC
TCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCTGAGCCT
TCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCAGCATCCTCCTCTGTTCTAACCACT
TCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAAGACAATGAGAGTAATTGCTTGACA
ACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAACATATGCAAAATACTGTACATTGT
GAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAACTATTAATGATAAAAATAATGCAT
TTGTATTGTTCATAATATCATGTGCACTTCAAGAAAATGGAATGCTACTCTTTTGTGGTTTACGTGTATTATTTTCAATATCTTAATACC

>In-frame_CCSER1_ENST00000333691_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_2464nt
GTTACCATCGAGACCGGGGCTGTGTATGCTCGAGGTGCAGGGAGCTAATGTATAAGGAGTTAAATGAACTCTTGCTGCTGCCAAATATGT
TGTTATCACTAACTGCACCGCTGCTGTCATTAGTGCTGCTGCCAACACTGCAAGCCCTGCTGCTGCCAGTGCCAATTCTGCTGATGCCTT
GGGCTCTCCATGTCCCAGGGTGATTCCATAGACAAGCAGCTGCTTTTAGATTTCACTTGCTCATTACCTGTAGATCCTTTGCCTTAGGAC
TCAAGCTTAAGCCCATGAAGCCTGGGATAGAAGACAATTGGAGGCTGCAAAGTTGGCTTTCACAGTGCAAGCCTTTGATTCCCAATGGGG
GACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCTTCTTCA
CCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGGAGCATA
TTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCAAATGGT
GCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGTAGTTCA
CGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAATTGTCTA
AGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTACTCCCT
AAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCATTGGAA
GTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGCTCTTTA
CAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAAATGGAT
GCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCTGCTGCT
GTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGTAGCACT
GAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTGAGCCAC
TCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCCCCAAGG
AAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCTACTTCT
GGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTTCGTGAA
GGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGAAATATA
GAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGATCTTGT
GAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCATATCAC
TCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCTGAGCCT
TCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCAGCATCCTCCTCTGTTCTAACCACT
TCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAAGACAATGAGAGTAATTGCTTGACA
ACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAACATATGCAAAATACTGTACATTGT
GAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAACTATTAATGATAAAAATAATGCAT

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000418378_chr4_88394955_-_2534nt
GTTACCATCGAGACCGGGGCTGTGTATGCTCGAGGTGCAGGGAGCTAATGTATAAGGAGTTAAATGAACTCTTGCTGCTGCCAAATATGT
TGTTATCACTAACTGCACCGCTGCTGTCATTAGTGCTGCTGCCAACACTGCAAGCCCTGCTGCTGCCAGTGCCAATTCTGCTGATGCCTT
GGGCTCTCCATGTCCCAGGGTGATTCCATAGACAAGCAGCTGCTTTTAGATTTCACTTGCTCATTACCTGTAGATCCTTTGCCTTAGGAC
TCAAGCTTAAGCCCATGAAGCCTGGGATAGAAGACAATTGGAGGCTGCAAAGTTGGCTTTCACAGTGCAAGCCTTTGATTCCCAATGGGG
GACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCTTCTTCA
CCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGGAGCATA
TTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCAAATGGT
GCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGTAGTTCA
CGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAATTGTCTA
AGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTACTCCCT
AAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCATTGGAA
GTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGCTCTTTA
CAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAAATGGAT
GCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCTGCTGCT
GTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGTAGCACT
GAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTGAGCCAC
TCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCCCCAAGG
AAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCTACTTCT
GGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTTCGTGAA
GGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGAAATATA
GAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGATCTTGT
GAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCATATCAC
TCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCTGAGCCT
TCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCAGCATCCTCCTCTGTTCTAACCACT
TCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAAGACAATGAGAGTAATTGCTTGACA
ACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAACATATGCAAAATACTGTACATTGT
GAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAACTATTAATGATAAAAATAATGCAT
TTGTATTGTTCATAATATCATGTGCACTTCAAGAAAATGGAATGCTACTCTTTTGTGGTTTACGTGTATTATTTTCAATATCTTAATACC

>In-frame_CCSER1_ENST00000432775_chr4_91389505_+_SPARCL1_ENST00000503414_chr4_88394955_-_2464nt
GTTACCATCGAGACCGGGGCTGTGTATGCTCGAGGTGCAGGGAGCTAATGTATAAGGAGTTAAATGAACTCTTGCTGCTGCCAAATATGT
TGTTATCACTAACTGCACCGCTGCTGTCATTAGTGCTGCTGCCAACACTGCAAGCCCTGCTGCTGCCAGTGCCAATTCTGCTGATGCCTT
GGGCTCTCCATGTCCCAGGGTGATTCCATAGACAAGCAGCTGCTTTTAGATTTCACTTGCTCATTACCTGTAGATCCTTTGCCTTAGGAC
TCAAGCTTAAGCCCATGAAGCCTGGGATAGAAGACAATTGGAGGCTGCAAAGTTGGCTTTCACAGTGCAAGCCTTTGATTCCCAATGGGG
GACTCAGGATCAAGACGATCTACCCTGGTCTCCCGGTTGCCAATATTCAGAAGAAGTATTAACAGAAGACATGATTCTCTTCCTTCTTCA
CCTTCTTCCAGTAATACAGTTGGTGTCCACAGTTCCTCTCCTTCCAGCACTAACTCAAGCTCAGGTAGCACAGGTAAACGGAGGAGCATA
TTCCGTACTCCTTCCATTAGCTTCCACCATAAGAAGGGGAGTGAGCCTAAGCAAGAGCCTACCAACCAGAACCTTAGTATTTCAAATGGT
GCTCAACCTGGTCACAGCAATATGCAGAAACTGAGTTTGGAAGAACATATTAAGACCAGGGGAAGACATTCTGTTGGTTTTAGTAGTTCA
CGAAATAAGAAGATAACAAGATCTTTGACAGAGGATTTTGAAAGGGAAAAAGAGCACTCAACTAACAAGAATGTCTTTATAAATTGTCTA
AGTTCTGGCAAAAGTGAAGGGGATGATTCTGGTTTCACAGAAGACCAAACTCGTCGTTCTGTTAAGCAGTCAACAAGGAAGCTACTCCCT
AAATCTTTTTCATCTCACTATAAATTTTCTAAGCCAGTTCTACAGAGCCAATCCATTTCATTGGTACAACAGTCTGAATTCTCATTGGAA
GTTACACAGTACCAAGAGAGAGAACCTGTATTAGTAAGAGCTTCGCCATCCTGTTCTGTGGATGTAACAGAACGGGCAGGAAGCTCTTTA
CAATCTCCTTTGCTTTCTGCTGATCTTACCACAGCTCAGACACCTTCAGAATTTTTAGCCTTGACTGAAGATTCTGTGTCTGAAATGGAT
GCATTTTCTAAAAGTGGAAGCATGGCATCCCACTGTGACAACTTTGGCCACAATGATTCTACCTCTCAGATGTCCCTCAATTCTGCTGCT
GTTACAAAGACAACAACAGAACTTACGGGAACTGTTCCCTGTGCAATTATGTCTCCTGGGAAATATAGGTTAGAGGGTCAATGTAGCACT
GAATCTAATTCATTACCGGAAACCTCTGCTGCTAATCAGAAGGAAGTGTTATTACAAATTGCTGAACTACCTGCTACAAGTGTGAGCCAC
TCAGAGAGTAACCTACCAGCAGATAGTGAAAGAGAAGAAAATATAGGGTTACAAAATGGTGAAACAATGCTGGGGACAAACTCCCCAAGG
AAACTTGGATTTTATGAGCAACATAAAGCAATAGCGGAACATGTAAAAGGGATCCATCCTATTTCAGATTCAAAGATAATACCTACTTCT
GGTGATCATCATATTTTTAACAAAACATCACATGGATATGAAGCAAATCCTGCCAAAGTTCTTGCCAGTAGTCTCAGTCCATTTCGTGAA
GGAAGATTTATAGAGAGGAGACTGCGATCCTCGTCAGAAGGCACTGCAGGGAGTAGCAGAATGATTTTGAAACCGAAAGATGGAAATATA
GAAGAAGTTAATAGTTTAAGAAAGCAAAGAGCAGGTTCTTCATCTTCAAAAATGAACAGTTTGGATGTTTTGAATAATTTGGGATCTTGT
GAACTGGATGAAGATGATCTAATGCTTGATCTTGAATTTTTAGAGGAACAGAGTCTTCACCCTTCTGTTTGCCGGGAGGACTCATATCAC
TCTGTCGTCTCATGTGCCGCAGTAGTTCTTACTCCTATGGAACCAATGATAGAAATGAAGAAAAGAGAAGAACCAGAATTTCCTGAGCCT
TCCAAACAAGGACATAGATGAAAATCTCTTGTTTTGAACGAAGATTTTAAAGAACTCAACTTTCCAGCATCCTCCTCTGTTCTAACCACT
TCAGAAATATATGCAGCTGTGATACTTGTAGATTTATATTTAGCAAAATGTTAGCATGTATGACAAGACAATGAGAGTAATTGCTTGACA
ACAACCTATGCACCAGGTATTTAACATTAACTTTGGAAACAAAAATGTACAATTAAGTAAAGTCAACATATGCAAAATACTGTACATTGT
GAACAGAAGTTTAATTCATAGTAATTTCACTCTCTGCATTGACTTATGAGATAATTAATGATTAAACTATTAATGATAAAAATAATGCAT


Top

FusionGenePPI for CCSER1_SPARCL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CCSER1NDEL1, SMYD2, NDE1, CYLDSPARCL1EGFR, DISC1, SKIL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CCSER1_SPARCL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CCSER1_SPARCL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCCSER1C0236736Cocaine-Related Disorders1CTD_human
TgeneSPARCL1C0014175Endometriosis1CTD_human
TgeneSPARCL1C0014544Epilepsy1CTD_human