FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 601

FusionGeneSummary for ACTN4_RPS16

check button Fusion gene summary
Fusion gene informationFusion gene name: ACTN4_RPS16
Fusion gene ID: 601
HgeneTgene
Gene symbol

ACTN4

RPS16

Gene ID

81

6217

Gene nameactinin alpha 4ribosomal protein S16
SynonymsACTININ-4|FSGS|FSGS1S16
Cytomap

19q13.2

19q13.2

Type of geneprotein-codingprotein-coding
Descriptionalpha-actinin-4focal segmental glomerulosclerosis 1non-muscle alpha-actinin 440S ribosomal protein S16small ribosomal subunit protein uS9
Modification date2018052220180523
UniProtAcc

O43707

P62249

Ensembl transtripts involved in fusion geneENST00000252699, ENST00000424234, 
ENST00000390009, ENST00000497637, 
ENST00000599539, ENST00000339471, 
ENST00000251453, ENST00000601655, 
Fusion gene scores* DoF score28 X 17 X 13=61885 X 5 X 3=75
# samples 308
** MAII scorelog2(30/6188*10)=-4.36643879095316
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/75*10)=0.0931094043914815
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ACTN4 [Title/Abstract] AND RPS16 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACTN4

GO:0035357

peroxisome proliferator activated receptor signaling pathway

22351778

HgeneACTN4

GO:0048384

retinoic acid receptor signaling pathway

22351778

HgeneACTN4

GO:0051272

positive regulation of cellular component movement

9508771


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-44-2662-01AACTN4chr19

39138547

+RPS16chr19

39926348

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000252699ENST00000599539ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000252699ENST00000339471ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000252699ENST00000251453ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000252699ENST00000601655ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000424234ENST00000599539ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000424234ENST00000339471ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000424234ENST00000251453ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000424234ENST00000601655ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000390009ENST00000599539ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000390009ENST00000339471ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000390009ENST00000251453ACTN4chr19

39138547

+RPS16chr19

39926348

-
In-frameENST00000390009ENST00000601655ACTN4chr19

39138547

+RPS16chr19

39926348

-
intron-3CDSENST00000497637ENST00000599539ACTN4chr19

39138547

+RPS16chr19

39926348

-
intron-3CDSENST00000497637ENST00000339471ACTN4chr19

39138547

+RPS16chr19

39926348

-
intron-3CDSENST00000497637ENST00000251453ACTN4chr19

39138547

+RPS16chr19

39926348

-
intron-3CDSENST00000497637ENST00000601655ACTN4chr19

39138547

+RPS16chr19

39926348

-

Top

FusionProtFeatures for ACTN4_RPS16


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACTN4

O43707

RPS16

P62249

F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures. This is a bundlingprotein (Probable). Probably involved in vesicular trafficking viaits association with the CART complex. The CART complex isnecessary for efficient transferrin receptor recycling but not forEGFR degradation (PubMed:15772161). Involved in tight junctionassembly in epithelial cells probably through interaction withMICALL2. Links MICALL2 to the actin cytoskeleton and recruits itto the tight junctions (By similarity). May also function as atranscriptional coactivator, stimulating transcription mediated bythe nuclear hormone receptors PPARG and RARA (PubMed:22351778).{ECO:0000250|UniProtKB:P57780, ECO:0000269|PubMed:15772161,ECO:0000269|PubMed:22351778, ECO:0000305|PubMed:9508771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+12119_2654912Compositional biasPoly-Gly
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+11419_2654693Compositional biasPoly-Gly

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121778_78954912Calcium binding1
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121819_83054912Calcium binding2
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114778_78954693Calcium binding1
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114819_83054693Calcium binding2
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121163_26954912DomainCalponin-homology (CH) 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+12150_15454912DomainCalponin-homology (CH) 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121765_80054912DomainEF-hand 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121806_84154912DomainEF-hand 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114163_26954693DomainCalponin-homology (CH) 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+11450_15454693DomainCalponin-homology (CH) 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114765_80054693DomainEF-hand 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114806_84154693DomainEF-hand 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+12184_8854912MotifLXXLL motif
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+11484_8854693MotifLXXLL motif
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121177_19254912RegionPolyphosphoinositide (PIP2)-binding
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+1211_26954912RegionNote=Actin-binding
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114177_19254693RegionPolyphosphoinositide (PIP2)-binding
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+1141_26954693RegionNote=Actin-binding
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121293_40354912RepeatSpectrin 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121413_51854912RepeatSpectrin 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121528_63954912RepeatSpectrin 3
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121649_75254912RepeatSpectrin 4
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114293_40354693RepeatSpectrin 1
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114413_51854693RepeatSpectrin 2
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114528_63954693RepeatSpectrin 3
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114649_75254693RepeatSpectrin 4


Top

FusionGeneSequence for ACTN4_RPS16


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_54aa

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_191aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITGESQELGAWRRWLWEGGLHSAPVPFNCVSFSQLSVSPSPKPWWPITRNMWMRLPRRRSKT

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_185aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITAIRQSISKALVATYQKTVDEASKKEIKDILIQTDRTLLVADPRRCESKKFGGPGARARYQ

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_168aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKLLEPVLLLGKERFAGVDIR

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_54aa

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_191aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITGESQELGAWRRWLWEGGLHSAPVPFNCVSFSQLSVSPSPKPWWPITRNMWMRLPRRRSKT

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_185aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITAIRQSISKALVATYQKTVDEASKKEIKDILIQTDRTLLVADPRRCESKKFGGPGARARYQ

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_168aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKLLEPVLLLGKERFAGVDIR

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_54aa

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_191aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITGESQELGAWRRWLWEGGLHSAPVPFNCVSFSQLSVSPSPKPWWPITRNMWMRLPRRRSKT

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_185aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
EPVLLLGKERFAGVDIRVRVKGGGHVAQITAIRQSISKALVATYQKTVDEASKKEIKDILIQTDRTLLVADPRRCESKKFGGPGARARYQ

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_168aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKKTATAVAHCKRGNGLIKLLEPVLLLGKERFAGVDIR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_162nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_573nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GGTGAGTCCCAGGAACTGGGCGCATGGAGGAGGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTGTGTCTTTC
TCACAGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACA

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_555nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTC
ATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAG

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_504nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGT
GTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATAT
GTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_162nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_573nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GGTGAGTCCCAGGAACTGGGCGCATGGAGGAGGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTGTGTCTTTC
TCACAGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_555nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTC
ATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAG

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_504nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGT
GTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATAT
GTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_162nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_573nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GGTGAGTCCCAGGAACTGGGCGCATGGAGGAGGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTGTGTCTTTC
TCACAGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACA

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_555nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTG
GAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTAT
GCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTC
ATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAG

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_504nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTG
GCGCACTGCAAACGCGGCAATGGTCTCATCAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGT
GTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATAT
GTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_725nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACG
CGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCT
TCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTC
CATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATGTGAGTGAGCATGGGTCCTTCCCATGAGATGTGGATGAGGCTTCCAAGAAGGAGA
TCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCC
GCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAAAACTCACTTGTATAATAAACAGTTTTTGAGGGATTTTAAAGTTTC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_792nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACG
CGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCT
TCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGGTGAGTCCCAGGA
ACTGGGCGCATGGAGGAGGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTGTGTCTTTCTCACAGCTATCCGT
CAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTAT
GACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTAC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_697nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACG
CGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCT
TCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTC
CATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCG
GACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATA

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_636nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACG
CGGCAATGGTCTCATCAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGG
TGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTC
CAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGG
CCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAAAACTCACTTGTATAATAAACAGTTTTTGAGGGAT

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_708nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCA
AGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGAT
TTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGG
TGGCCTATTACCAGAAATGTGAGTGAGCATGGGTCCTTCCCATGAGATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATC
CAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_775nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCA
AGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGAT
TTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGGTGAGTCCCAGGAACTGGGCGCATGGAGGA
GGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTGTGTCTTTCTCACAGCTATCCGTCAGTCCATCTCCAAAGC
CCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGT
AGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_680nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCA
AGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGAT
TTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGG
TGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTG
ACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_619nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGACAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCA
AGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCC
AGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAG
ACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000599539_chr19_39926348_-_657nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGA
CAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACA
AGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCC
AGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATGTGAGTGAGCATGGGTCCTTCCCATGAGATGTG
GATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAA
AAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAAAACTCACTTGTATAATAAACAGT

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000339471_chr19_39926348_-_724nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGA
CAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACA
AGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCC
AGATTTATGGTGAGTCCCAGGAACTGGGCGCATGGAGGAGGTGGCTCTGGGAGGGAGGCCTTCACAGCGCTCCTGTACCCTTTAATTGTG
TGTCTTTCTCACAGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGAT
CAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCG
CGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAAAACTCACTTGTATAATAAACAGTTTTTGAGGGATTTTAAAGTTTCA

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000251453_chr19_39926348_-_629nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGA
CAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCAAGGTGAACGGGCGGCCCCTGGAGATGATTGAGCCGCGCACGCTACAGTACA
AGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAGACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCC
AGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACCAGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAG
ACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCTGCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_RPS16_ENST00000601655_chr19_39926348_-_568nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGAAGACAGCGA
CAGCTGTGGCGCACTGCAAACGCGGCAATGGTCTCATCAAGCTGCTGGAGCCAGTTCTGCTTCTCGGCAAGGAGCGATTTGCTGGTGTAG
ACATCCGTGTCCGTGTAAAGGGTGGTGGTCACGTGGCCCAGATTTATGCTATCCGTCAGTCCATCTCCAAAGCCCTGGTGGCCTATTACC
AGAAATATGTGGATGAGGCTTCCAAGAAGGAGATCAAAGACATCCTCATCCAGTATGACCGGACCCTGCTGGTAGCTGACCCTCGTCGCT
GCGAGTCCAAAAAGTTTGGAGGCCCTGGTGCCCGCGCTCGCTACCAGAAATCCTACCGATAAGCCCATCGTGACTCAAAACTCACTTGTA


Top

FusionGenePPI for ACTN4_RPS16


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACTN4MYOZ2, MYOZ1, PDLIM1, USP6NL, SLC9A3R2, COL17A1, TRIM3, MAGI1, GSN, CAMK2A, CAMK2B, INO80, UBTF, STAT1, HDAC7, MEF2A, UCHL5, TJP1, ATXN7, HDAC5, VDR, ESR1, PSMA3, ELAVL1, SIRT7, SLC2A4, ISG15, COIL, SACS, HGS, UBASH3B, SHC1, NOS3, ACTN2, ACTN1, FMNL1, TRAF3IP1, FN1, VCAM1, CDH1, ITGA4, SVIL, CD81, IGSF8, ICAM1, TXN, RPS27, POT1, KPNA2, MAPK7, CDKN2A, VCP, SF3A3, GNB2, HUWE1, ACTN3, BMP7, ALK, CUL7, OBSL1, CCDC8, EGFR, LUZP4, RARA, HSPB1, AHNAK, ALDOA, ALDOC, IDH3A, MYH15, MYH2, MYH7B, NCAPG2, PSMA6, PSMB5, PUS7, TPM2, TSG101, CKB, CYC1, ECSIT, MCFD2, PSMB8, TPM1, TPM3, TPM4, NTRK1, CAPZA2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, SIN3B, MYEF2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, CTNNB1, MCM2, NFYA, CDC73, DDIAS, SSH1, NCL, DLD, DNM1L, PDHA1, SOD1, TRIM25, TESRPS16MAGEB2, DDX56, CNBP, PINX1, CDC5L, TERF1, NOP56, RAD21, NDRG1, SIRT7, CUL3, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, CAND1, NEDD8, RPS4X, APP, RPL12, RPL13, RPS25, RPL10A, RPL11, RPL14, RPL15, RPL18A, RPL18, RPL19, RPL21, RPL23A, RPL23, RPL24, RPL27A, RPL27, RPL31, RPL37A, RPL3, RPL4, RPL5, RPL6, RPL7A, RPL7, RPL8, RPL9, RPLP1, RPS12, RPS13, RPS19, RPS23, RPS26, RPS28, RPS2, RPS3A, RPS3, RPS5, RPS6, RPS8, RPSA, RPS11, RPS17, RPS15A, RPL10, RPS24, RPLP2, RPS20, RPL22, RPLP0, RPS10, RPS15, RPS9, RPS7, RPL30, RPS14, RPL36, RPS21, RPS27A, FAU, RPL17, RPL29, RPL32, EEF2, EEF1A1, RPS29, ILF2, ILF3, HNRNPM, NCL, HNRNPU, TUFM, ACTA2, HSP90AB1, RPL10L, RPLP0P6, RPS27L, PPT2, PRKCDBP, ATP5I, CDH2, HSP90AA1, MLEC, TXN2, UQCRB, DDX5, HSPA5, HSP90AA5P, RPS10P5, RBM8A, ESR1, SMURF1, FN1, VCAM1, UBL4A, ITGA4, PAN2, CD81, IGSF8, ICAM1, LARP7, TARDBP, PARK2, LARP1, DYNLT3, EIF2A, EIF3L, GNB2L1, RPS18, WIBG, RPS27, SND1, TSR1, ASB14, ASB15, ZBTB1, AURKA, AURKB, CDKN1A, CEP250, CEP57, CEP76, TUBG1, TUBGCP4, TP53, HUWE1, EED, ATP6V0D1, RPL13A, RPL28, RPL34, RPL35, RPL35A, RPL38, RPL3L, PABPC1, RPL26, RPL26L1, LOC101929876, VAPA, SFN, XPO1, AHSA1, NPM1, CKAP5, CENPQ, EXOSC5, EXOSC1, SKI, MCM2, ESRRB, RC3H1, WDR4, ZNF746, RRS1, HIST1H1E, H2AFX, RPF1, FGF8, BHLHA15, E4F1, CYLD, INO80B, TRIM25, HEY1, BRCA1, MTF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+12112_2654912VCL
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+11412_2654693VCL


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+121108_12654912VCL
HgeneACTN4chr19:39138547chr19:39926348ENST00000252699+12140_6154912VCL
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+114108_12654693VCL
HgeneACTN4chr19:39138547chr19:39926348ENST00000390009+11440_6154693VCL


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACTN4_RPS16


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACTN4_RPS16


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACTN4C0333497Segmental glomerulosclerosis3UNIPROT
HgeneACTN4C0024667Animal Mammary Neoplasms1CTD_human
HgeneACTN4C0024668Mammary Neoplasms, Experimental1CTD_human