FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 592

FusionGeneSummary for ACTN4_KIRREL2

check button Fusion gene summary
Fusion gene informationFusion gene name: ACTN4_KIRREL2
Fusion gene ID: 592
HgeneTgene
Gene symbol

ACTN4

KIRREL2

Gene ID

81

84063

Gene nameactinin alpha 4kirre like nephrin family adhesion molecule 2
SynonymsACTININ-4|FSGS|FSGS1FILTRIN|NEPH3|NLG1
Cytomap

19q13.2

19q13.12

Type of geneprotein-codingprotein-coding
Descriptionalpha-actinin-4focal segmental glomerulosclerosis 1non-muscle alpha-actinin 4kin of IRRE-like protein 2kin of IRRE like 2kin of irregular chiasm-like protein 2nephrin-like gene 1nephrin-like protein 3
Modification date2018052220180526
UniProtAcc

O43707

Q6UWL6

Ensembl transtripts involved in fusion geneENST00000252699, ENST00000424234, 
ENST00000390009, ENST00000497637, 
ENST00000592409, ENST00000347900, 
ENST00000360202, ENST00000262625, 
Fusion gene scores* DoF score28 X 17 X 13=61882 X 1 X 2=4
# samples 302
** MAII scorelog2(30/6188*10)=-4.36643879095316
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: ACTN4 [Title/Abstract] AND KIRREL2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACTN4

GO:0035357

peroxisome proliferator activated receptor signaling pathway

22351778

HgeneACTN4

GO:0048384

retinoic acid receptor signaling pathway

22351778

HgeneACTN4

GO:0051272

positive regulation of cellular component movement

9508771


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-34-5241-01AACTN4chr19

39138547

+KIRREL2chr19

36355550

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000252699ENST00000592409ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000252699ENST00000347900ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000252699ENST00000360202ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000252699ENST00000262625ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000424234ENST00000592409ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000424234ENST00000347900ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000424234ENST00000360202ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000424234ENST00000262625ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000390009ENST00000592409ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000390009ENST00000347900ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000390009ENST00000360202ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
In-frameENST00000390009ENST00000262625ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
intron-3CDSENST00000497637ENST00000592409ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
intron-3CDSENST00000497637ENST00000347900ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
intron-3CDSENST00000497637ENST00000360202ACTN4chr19

39138547

+KIRREL2chr19

36355550

+
intron-3CDSENST00000497637ENST00000262625ACTN4chr19

39138547

+KIRREL2chr19

36355550

+

Top

FusionProtFeatures for ACTN4_KIRREL2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACTN4

O43707

KIRREL2

Q6UWL6

F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures. This is a bundlingprotein (Probable). Probably involved in vesicular trafficking viaits association with the CART complex. The CART complex isnecessary for efficient transferrin receptor recycling but not forEGFR degradation (PubMed:15772161). Involved in tight junctionassembly in epithelial cells probably through interaction withMICALL2. Links MICALL2 to the actin cytoskeleton and recruits itto the tight junctions (By similarity). May also function as atranscriptional coactivator, stimulating transcription mediated bythe nuclear hormone receptors PPARG and RARA (PubMed:22351778).{ECO:0000250|UniProtKB:P57780, ECO:0000269|PubMed:15772161,ECO:0000269|PubMed:22351778, ECO:0000305|PubMed:9508771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+12119_2654912Compositional biasPoly-Gly
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+11419_2654693Compositional biasPoly-Gly
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216626_702575634Compositional biasNote=Pro-rich
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115565_568525584Compositional biasNote=Poly-Glu
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115626_702525584Compositional biasNote=Pro-rich
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215626_702575709Compositional biasNote=Pro-rich
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115532_708525584Topological domainCytoplasmic

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121778_78954912Calcium binding1
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121819_83054912Calcium binding2
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114778_78954693Calcium binding1
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114819_83054693Calcium binding2
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121163_26954912DomainCalponin-homology (CH) 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+12150_15454912DomainCalponin-homology (CH) 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121765_80054912DomainEF-hand 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121806_84154912DomainEF-hand 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114163_26954693DomainCalponin-homology (CH) 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+11450_15454693DomainCalponin-homology (CH) 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114765_80054693DomainEF-hand 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114806_84154693DomainEF-hand 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+12184_8854912MotifLXXLL motif
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+11484_8854693MotifLXXLL motif
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121177_19254912RegionPolyphosphoinositide (PIP2)-binding
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+1211_26954912RegionNote=Actin-binding
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114177_19254693RegionPolyphosphoinositide (PIP2)-binding
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+1141_26954693RegionNote=Actin-binding
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121293_40354912RepeatSpectrin 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121413_51854912RepeatSpectrin 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121528_63954912RepeatSpectrin 3
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121649_75254912RepeatSpectrin 4
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114293_40354693RepeatSpectrin 1
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114413_51854693RepeatSpectrin 2
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114528_63954693RepeatSpectrin 3
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114649_75254693RepeatSpectrin 4
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216565_568575634Compositional biasNote=Poly-Glu
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215565_568575709Compositional biasNote=Poly-Glu
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216123_222575634DomainNote=Ig-like C2-type 2
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216227_307575634DomainNote=Ig-like C2-type 3
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+121624_118575634DomainNote=Ig-like C2-type 1
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216312_394575634DomainNote=Ig-like C2-type 4
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216398_501575634DomainNote=Ig-like C2-type 5
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115123_222525584DomainNote=Ig-like C2-type 2
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115227_307525584DomainNote=Ig-like C2-type 3
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+111524_118525584DomainNote=Ig-like C2-type 1
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115312_394525584DomainNote=Ig-like C2-type 4
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115398_501525584DomainNote=Ig-like C2-type 5
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215123_222575709DomainNote=Ig-like C2-type 2
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215227_307575709DomainNote=Ig-like C2-type 3
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+121524_118575709DomainNote=Ig-like C2-type 1
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215312_394575709DomainNote=Ig-like C2-type 4
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215398_501575709DomainNote=Ig-like C2-type 5
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216149_151575634MotifCell attachment site
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115149_151525584MotifCell attachment site
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215149_151575709MotifCell attachment site
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+121621_510575634Topological domainExtracellular
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216532_708575634Topological domainCytoplasmic
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+111521_510525584Topological domainExtracellular
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+121521_510575709Topological domainExtracellular
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215532_708575709Topological domainCytoplasmic
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000262625+1216511_531575634TransmembraneHelical
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000347900+1115511_531525584TransmembraneHelical
TgeneKIRREL2chr19:39138547chr19:36355550ENST00000360202+1215511_531575709TransmembraneHelical


Top

FusionGeneSequence for ACTN4_KIRREL2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_188aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSV
SLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSH

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_113aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKGPIVHTDHSDLVLEEKGTLETKDPTNGYYKVRGVSP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_564nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTG
AGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGAC
TTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACC
AGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCAC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_339nt
ATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGAC
TACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACT
GACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_648nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCT
GGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTGAGCCTGAGCCTTGG
CGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGACTTCAACCCACACCT
GGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACCAGCTACATCAAACC
CACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCACCCGCGTCTCCAGAC

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_468nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCT
GGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCACCCGCGTCTCCAGA
CTCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGT

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_1257nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCT
GGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTGAGCCTGAGCCTTGG
CGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGACTTCAACCCACACCT
GGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACCAGCTACATCAAACC
CACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCACCCGCGTCTCCAGAC
TCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGTT
GGCGACCTTACTCCTCCAAAACTGAACACAAGGGGAGGGAAAGATCATTACATTTGTCAGGAGCATTTGTATACAGTCAGCTCAGCCAAA
GGAGATGCCCCAAGTGGGAGCAACATGGCCACCCAATATGCCCACCTATTCCCCGGTGTAAAAGAGATTCAAGATGGCAGGTAGGCCCTT
TGAGGAGAGATGGGGACAGGGCAGTGGGTGTTGGGAGTTTGGGGCCGGGATGGAAGTTGTTTCTAGCCACTGAAAGAAGATATTTCAAGA
TGACCATCTGCATTGAGAGGAAAGGTAGCATAGGATAGATGAAGATGAAGAGCATACCAGGCCCCACCCTGGCTCTCCCTGAGGGGAACT
TTGCTCGGCCAATGGAAATGCAGCCAAGATGGCCATATACTCCCTAGGAACCCAAGATGGCCACCATCTTGATTTTACTTTCCTTAAAGA

>In-frame_ACTN4_ENST00000252699_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_468nt
GCGGCGGCGGCTCGGGCAGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCA
CGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGA
GGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCT
GGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCACCCGCGTCTCCAGA
CTCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGT

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_631nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAG
GGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTGAGCCTGAGCCTTGGCGAAGCCCCTGGAGGAG
GTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGACTTCAACCCACACCTGGGCATGGTCCCCCCCT
GCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACCAGCTACATCAAACCCACATCCTTTGGGCCCC
CAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCACCCGCGTCTCCAGACTCACGTGTGACATCTTT

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_451nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAG
GGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCACCCGCGTCTCCAGACTCACGTGTGACATCTT
TCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGTTGGCGACCTTACTCCTC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_1240nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAG
GGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTGTGAGCCTGAGCCTTGGCGAAGCCCCTGGAGGAG
GTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCTTCTATGACTTCAACCCACACCTGGGCATGGTCCCCCCCT
GCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAGCTTTCACCAGCTACATCAAACCCACATCCTTTGGGCCCC
CAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACACCTAGCCACCCGCGTCTCCAGACTCACGTGTGACATCTTT
CCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGTTGGCGACCTTACTCCTCC
AAAACTGAACACAAGGGGAGGGAAAGATCATTACATTTGTCAGGAGCATTTGTATACAGTCAGCTCAGCCAAAGGAGATGCCCCAAGTGG
GAGCAACATGGCCACCCAATATGCCCACCTATTCCCCGGTGTAAAAGAGATTCAAGATGGCAGGTAGGCCCTTTGAGGAGAGATGGGGAC
AGGGCAGTGGGTGTTGGGAGTTTGGGGCCGGGATGGAAGTTGTTTCTAGCCACTGAAAGAAGATATTTCAAGATGACCATCTGCATTGAG
AGGAAAGGTAGCATAGGATAGATGAAGATGAAGAGCATACCAGGCCCCACCCTGGCTCTCCCTGAGGGGAACTTTGCTCGGCCAATGGAA
ATGCAGCCAAGATGGCCATATACTCCCTAGGAACCCAAGATGGCCACCATCTTGATTTTACTTTCCTTAAAGACTCAGAAAGACTTGGAC

>In-frame_ACTN4_ENST00000424234_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_451nt
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGT
ACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTGTGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAG
GGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAGTCAGTCCACCCGCGTCTCCAGACTCACGTGTGACATCTT
TCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGATTTCTGAGGAGCCAGGACAAGTTGGCGACCTTACTCCTC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000592409_chr19_36355550_+_580nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTG
TGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAG
TCAGTGTGAGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCT
TCTATGACTTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAG
CTTTCACCAGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACAC

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000347900_chr19_36355550_+_400nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTG
TGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAG
TCAGTCCACCCGCGTCTCCAGACTCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGA

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000360202_chr19_36355550_+_1189nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTG
TGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAG
TCAGTGTGAGCCTGAGCCTTGGCGAAGCCCCTGGAGGAGGTCTCTTCCTGCCACCACCCTCCCCCCTTGGGCCCCCAGGGACCCCTACCT
TCTATGACTTCAACCCACACCTGGGCATGGTCCCCCCCTGCAGACTTTACAGAGCCAGGGCAGGCTATCTCACCACACCCCACCCTCGAG
CTTTCACCAGCTACATCAAACCCACATCCTTTGGGCCCCCAGATCTGGCCCCCGGGACTCCCCCCTTCCCATATGCTGCCTTCCCCACAC
CTAGCCACCCGCGTCTCCAGACTCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGAT
TTCTGAGGAGCCAGGACAAGTTGGCGACCTTACTCCTCCAAAACTGAACACAAGGGGAGGGAAAGATCATTACATTTGTCAGGAGCATTT
GTATACAGTCAGCTCAGCCAAAGGAGATGCCCCAAGTGGGAGCAACATGGCCACCCAATATGCCCACCTATTCCCCGGTGTAAAAGAGAT
TCAAGATGGCAGGTAGGCCCTTTGAGGAGAGATGGGGACAGGGCAGTGGGTGTTGGGAGTTTGGGGCCGGGATGGAAGTTGTTTCTAGCC
ACTGAAAGAAGATATTTCAAGATGACCATCTGCATTGAGAGGAAAGGTAGCATAGGATAGATGAAGATGAAGAGCATACCAGGCCCCACC
CTGGCTCTCCCTGAGGGGAACTTTGCTCGGCCAATGGAAATGCAGCCAAGATGGCCATATACTCCCTAGGAACCCAAGATGGCCACCATC
TTGATTTTACTTTCCTTAAAGACTCAGAAAGACTTGGACCCAAGGAGTGGGGATACAGTGAGAATTACCACTGTTGGGGCAAAATATTGG

>In-frame_ACTN4_ENST00000390009_chr19_39138547_+_KIRREL2_ENST00000262625_chr19_36355550_+_400nt
GCGGCGGAATGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATGGCGCTGGCGGCGGGGGCAGCA
TGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGGACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGGGCCCCATTG
TGCACACTGACCACAGTGATCTGGTTCTGGAGGAGAAAGGGACTCTGGAGACCAAGGACCCAACCAACGGTTACTACAAGGTCCGAGGAG
TCAGTCCACCCGCGTCTCCAGACTCACGTGTGACATCTTTCCAATGGAAGAGTCCTGGGATCTCCAACTTGCCATAATGGATTGTTCTGA


Top

FusionGenePPI for ACTN4_KIRREL2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACTN4MYOZ2, MYOZ1, PDLIM1, USP6NL, SLC9A3R2, COL17A1, TRIM3, MAGI1, GSN, CAMK2A, CAMK2B, INO80, UBTF, STAT1, HDAC7, MEF2A, UCHL5, TJP1, ATXN7, HDAC5, VDR, ESR1, PSMA3, ELAVL1, SIRT7, SLC2A4, ISG15, COIL, SACS, HGS, UBASH3B, SHC1, NOS3, ACTN2, ACTN1, FMNL1, TRAF3IP1, FN1, VCAM1, CDH1, ITGA4, SVIL, CD81, IGSF8, ICAM1, TXN, RPS27, POT1, KPNA2, MAPK7, CDKN2A, VCP, SF3A3, GNB2, HUWE1, ACTN3, BMP7, ALK, CUL7, OBSL1, CCDC8, EGFR, LUZP4, RARA, HSPB1, AHNAK, ALDOA, ALDOC, IDH3A, MYH15, MYH2, MYH7B, NCAPG2, PSMA6, PSMB5, PUS7, TPM2, TSG101, CKB, CYC1, ECSIT, MCFD2, PSMB8, TPM1, TPM3, TPM4, NTRK1, CAPZA2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, SIN3B, MYEF2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, CTNNB1, MCM2, NFYA, CDC73, DDIAS, SSH1, NCL, DLD, DNM1L, PDHA1, SOD1, TRIM25, TESKIRREL2FHL3, PSMA3, CPS1, MAPK3, FBXO11, PIGS, LEPREL2, AURKA, MANBA, VHL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+12112_2654912VCL
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+11412_2654693VCL


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+121108_12654912VCL
HgeneACTN4chr19:39138547chr19:36355550ENST00000252699+12140_6154912VCL
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+114108_12654693VCL
HgeneACTN4chr19:39138547chr19:36355550ENST00000390009+11440_6154693VCL


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACTN4_KIRREL2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACTN4_KIRREL2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACTN4C0333497Segmental glomerulosclerosis3UNIPROT
HgeneACTN4C0024667Animal Mammary Neoplasms1CTD_human
HgeneACTN4C0024668Mammary Neoplasms, Experimental1CTD_human