FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5911

FusionGeneSummary for CCDC82_MTMR2

check button Fusion gene summary
Fusion gene informationFusion gene name: CCDC82_MTMR2
Fusion gene ID: 5911
HgeneTgene
Gene symbol

CCDC82

MTMR2

Gene ID

79780

8898

Gene namecoiled-coil domain containing 82myotubularin related protein 2
SynonymsHSPC048CMT4B|CMT4B1
Cytomap

11q21

11q21

Type of geneprotein-codingprotein-coding
Descriptioncoiled-coil domain-containing protein 82myotubularin-related protein 2phosphatidylinositol-3,5-bisphosphate 3-phosphatasephosphatidylinositol-3-phosphatasephosphatidylinositol-3-phosphate phosphatasephosphoinositide-3-phosphatase
Modification date2018052520180519
UniProtAcc

Q8N4S0

Q13614

Ensembl transtripts involved in fusion geneENST00000278520, ENST00000542662, 
ENST00000423339, ENST00000525786, 
ENST00000393223, ENST00000346299, 
ENST00000409459, ENST00000352297, 
ENST00000484818, 
Fusion gene scores* DoF score1 X 1 X 1=13 X 3 X 2=18
# samples 13
** MAII scorelog2(1/1*10)=3.32192809488736log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CCDC82 [Title/Abstract] AND MTMR2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMTMR2

GO:0046856

phosphatidylinositol dephosphorylation

12668758

TgeneMTMR2

GO:0060304

regulation of phosphatidylinositol dephosphorylation

16787938


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-HU-A4HD-01ACCDC82chr11

96104177

-MTMR2chr11

95583913

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000278520ENST00000393223CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000278520ENST00000346299CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000278520ENST00000409459CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000278520ENST00000352297CCDC82chr11

96104177

-MTMR2chr11

95583913

-
5CDS-5UTRENST00000278520ENST00000484818CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000542662ENST00000393223CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000542662ENST00000346299CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000542662ENST00000409459CCDC82chr11

96104177

-MTMR2chr11

95583913

-
Frame-shitENST00000542662ENST00000352297CCDC82chr11

96104177

-MTMR2chr11

95583913

-
5CDS-5UTRENST00000542662ENST00000484818CCDC82chr11

96104177

-MTMR2chr11

95583913

-
In-frameENST00000423339ENST00000393223CCDC82chr11

96104177

-MTMR2chr11

95583913

-
In-frameENST00000423339ENST00000346299CCDC82chr11

96104177

-MTMR2chr11

95583913

-
In-frameENST00000423339ENST00000409459CCDC82chr11

96104177

-MTMR2chr11

95583913

-
In-frameENST00000423339ENST00000352297CCDC82chr11

96104177

-MTMR2chr11

95583913

-
5CDS-5UTRENST00000423339ENST00000484818CCDC82chr11

96104177

-MTMR2chr11

95583913

-
intron-3CDSENST00000525786ENST00000393223CCDC82chr11

96104177

-MTMR2chr11

95583913

-
intron-3CDSENST00000525786ENST00000346299CCDC82chr11

96104177

-MTMR2chr11

95583913

-
intron-3CDSENST00000525786ENST00000409459CCDC82chr11

96104177

-MTMR2chr11

95583913

-
intron-3CDSENST00000525786ENST00000352297CCDC82chr11

96104177

-MTMR2chr11

95583913

-
intron-5UTRENST00000525786ENST00000484818CCDC82chr11

96104177

-MTMR2chr11

95583913

-

Top

FusionProtFeatures for CCDC82_MTMR2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CCDC82

Q8N4S0

MTMR2

Q13614

Phosphatase that acts on lipids with a phosphoinositolheadgroup. Has phosphatase activity towards phosphatidylinositol3-phosphate and phosphatidylinositol 3,5-bisphosphate.{ECO:0000269|PubMed:11733541, ECO:0000269|PubMed:12668758,ECO:0000269|PubMed:21372139}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CCDC82_MTMR2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000393223_chr11_95583913_-_829aa
MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDESFENDEELDSNKGPDCNKTPGSERELNLSKI
QSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQTGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRG
KRKRLSSVMCDSDESDDSDILVRKVGVKRPRRVVEDEGSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCP
SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTL
YDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRG
RIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHN
IHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGF
EVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPK
RTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSS

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000346299_chr11_95583913_-_829aa
MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDESFENDEELDSNKGPDCNKTPGSERELNLSKI
QSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQTGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRG
KRKRLSSVMCDSDESDDSDILVRKVGVKRPRRVVEDEGSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCP
SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTL
YDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRG
RIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHN
IHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGF
EVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPK
RTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSS

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000409459_chr11_95583913_-_829aa
MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDESFENDEELDSNKGPDCNKTPGSERELNLSKI
QSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQTGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRG
KRKRLSSVMCDSDESDDSDILVRKVGVKRPRRVVEDEGSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCP
SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTL
YDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRG
RIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHN
IHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGF
EVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPK
RTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSS

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000352297_chr11_95583913_-_829aa
MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDESFENDEELDSNKGPDCNKTPGSERELNLSKI
QSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQTGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRG
KRKRLSSVMCDSDESDDSDILVRKVGVKRPRRVVEDEGSSVEMEQKTPEKTLAAQKREKLQKLKELSKQRSRQRRSSGRDFEDSEKESCP
SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTL
YDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRG
RIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHN
IHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGF
EVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPK
RTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000393223_chr11_95583913_-_2487nt
ATGATACATGTTAGAAGACATGAAACAAGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAA
AGAAGTAGTATCTCACAATTACTTGATAGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGT
TTTGAAAATGATGAAGAGCTTGATAGTAACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATT
CAAAGTGAAGGAAATGACAGTAAGTGTCTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAAT
ATTGACTTACAAGATCAGGAAAAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAA
AAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGA
AAAAGAAAAAGGCTATCCTCTGTGATGTGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCC
CGTAGAGTGGTTGAAGATGAAGGTTCTTCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTT
CAGAAGCTCAAAGAACTCTCAAAACAAAGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCA
AGCAGTGATGAAGTTGATGAGGAGGAAGAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTG
CAAGATGAGGAGGGTGATGAAGAGAATAAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTT
TATTCTTTTAGTGACCACTATACTCATTTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTA
TATGATGGCACAAGGCAAAAATCATATGCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAG
AGCTTGGTATCTAGAAGTCGTTGGAAAGAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAA
CTTTGTGATACATACCCTGCCCTCCTGGTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGC
CGTATCCCAGTTTTATCATGGATTCATCCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGA
AGCAAAGAAGATGAAAAATACCTTCAAGCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTT
AATGCTGTTGCCAACAAGGCAAAGGGTGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAAT
ATTCATGTTATGAGAGAATCATTACGAAAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCT
ACTCATTGGCTAGAACATATTAAGCTTATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTG
CATTGCAGTGATGGTTGGGATCGCACAGCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTT
GAAGTCCTTGTGGAGAAAGAATGGCTAAGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGAC
AGATCGCCTGTTTTTCTTCAATTTATTGACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTC
ATTACCATTTTGGACCACCTATACAGCTGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAA
AGGACTGTGTCACTGTGGTCTTACATAAACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTAT
CCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAAC
AGATACAAAGAACTTCTTGCTAAACGAGCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCC

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000346299_chr11_95583913_-_2487nt
ATGATACATGTTAGAAGACATGAAACAAGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAA
AGAAGTAGTATCTCACAATTACTTGATAGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGT
TTTGAAAATGATGAAGAGCTTGATAGTAACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATT
CAAAGTGAAGGAAATGACAGTAAGTGTCTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAAT
ATTGACTTACAAGATCAGGAAAAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAA
AAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGA
AAAAGAAAAAGGCTATCCTCTGTGATGTGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCC
CGTAGAGTGGTTGAAGATGAAGGTTCTTCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTT
CAGAAGCTCAAAGAACTCTCAAAACAAAGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCA
AGCAGTGATGAAGTTGATGAGGAGGAAGAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTG
CAAGATGAGGAGGGTGATGAAGAGAATAAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTT
TATTCTTTTAGTGACCACTATACTCATTTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTA
TATGATGGCACAAGGCAAAAATCATATGCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAG
AGCTTGGTATCTAGAAGTCGTTGGAAAGAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAA
CTTTGTGATACATACCCTGCCCTCCTGGTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGC
CGTATCCCAGTTTTATCATGGATTCATCCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGA
AGCAAAGAAGATGAAAAATACCTTCAAGCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTT
AATGCTGTTGCCAACAAGGCAAAGGGTGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAAT
ATTCATGTTATGAGAGAATCATTACGAAAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCT
ACTCATTGGCTAGAACATATTAAGCTTATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTG
CATTGCAGTGATGGTTGGGATCGCACAGCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTT
GAAGTCCTTGTGGAGAAAGAATGGCTAAGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGAC
AGATCGCCTGTTTTTCTTCAATTTATTGACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTC
ATTACCATTTTGGACCACCTATACAGCTGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAA
AGGACTGTGTCACTGTGGTCTTACATAAACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTAT
CCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAAC
AGATACAAAGAACTTCTTGCTAAACGAGCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCC

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000409459_chr11_95583913_-_2487nt
ATGATACATGTTAGAAGACATGAAACAAGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAA
AGAAGTAGTATCTCACAATTACTTGATAGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGT
TTTGAAAATGATGAAGAGCTTGATAGTAACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATT
CAAAGTGAAGGAAATGACAGTAAGTGTCTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAAT
ATTGACTTACAAGATCAGGAAAAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAA
AAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGA
AAAAGAAAAAGGCTATCCTCTGTGATGTGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCC
CGTAGAGTGGTTGAAGATGAAGGTTCTTCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTT
CAGAAGCTCAAAGAACTCTCAAAACAAAGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCA
AGCAGTGATGAAGTTGATGAGGAGGAAGAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTG
CAAGATGAGGAGGGTGATGAAGAGAATAAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTT
TATTCTTTTAGTGACCACTATACTCATTTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTA
TATGATGGCACAAGGCAAAAATCATATGCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAG
AGCTTGGTATCTAGAAGTCGTTGGAAAGAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAA
CTTTGTGATACATACCCTGCCCTCCTGGTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGC
CGTATCCCAGTTTTATCATGGATTCATCCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGA
AGCAAAGAAGATGAAAAATACCTTCAAGCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTT
AATGCTGTTGCCAACAAGGCAAAGGGTGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAAT
ATTCATGTTATGAGAGAATCATTACGAAAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCT
ACTCATTGGCTAGAACATATTAAGCTTATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTG
CATTGCAGTGATGGTTGGGATCGCACAGCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTT
GAAGTCCTTGTGGAGAAAGAATGGCTAAGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGAC
AGATCGCCTGTTTTTCTTCAATTTATTGACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTC
ATTACCATTTTGGACCACCTATACAGCTGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAA
AGGACTGTGTCACTGTGGTCTTACATAAACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTAT
CCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAAC
AGATACAAAGAACTTCTTGCTAAACGAGCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCC

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000352297_chr11_95583913_-_2487nt
ATGATACATGTTAGAAGACATGAAACAAGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAA
AGAAGTAGTATCTCACAATTACTTGATAGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGT
TTTGAAAATGATGAAGAGCTTGATAGTAACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATT
CAAAGTGAAGGAAATGACAGTAAGTGTCTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAAT
ATTGACTTACAAGATCAGGAAAAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAA
AAACATTTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGA
AAAAGAAAAAGGCTATCCTCTGTGATGTGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCC
CGTAGAGTGGTTGAAGATGAAGGTTCTTCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTT
CAGAAGCTCAAAGAACTCTCAAAACAAAGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCA
AGCAGTGATGAAGTTGATGAGGAGGAAGAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTG
CAAGATGAGGAGGGTGATGAAGAGAATAAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTT
TATTCTTTTAGTGACCACTATACTCATTTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTA
TATGATGGCACAAGGCAAAAATCATATGCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAG
AGCTTGGTATCTAGAAGTCGTTGGAAAGAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAA
CTTTGTGATACATACCCTGCCCTCCTGGTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGC
CGTATCCCAGTTTTATCATGGATTCATCCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGA
AGCAAAGAAGATGAAAAATACCTTCAAGCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTT
AATGCTGTTGCCAACAAGGCAAAGGGTGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAAT
ATTCATGTTATGAGAGAATCATTACGAAAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCT
ACTCATTGGCTAGAACATATTAAGCTTATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTG
CATTGCAGTGATGGTTGGGATCGCACAGCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTT
GAAGTCCTTGTGGAGAAAGAATGGCTAAGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGAC
AGATCGCCTGTTTTTCTTCAATTTATTGACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTC
ATTACCATTTTGGACCACCTATACAGCTGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAA
AGGACTGTGTCACTGTGGTCTTACATAAACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTAT
CCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAAC
AGATACAAAGAACTTCTTGCTAAACGAGCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000393223_chr11_95583913_-_5138nt
CAGCACAACATACAACGTAATTCAGAGTAGATGTTCATATAATTATTTCATGGGCATTCAGTAAATTATTTGTTAAATTAATGTTCTACC
ATCTTCACTCAGATATTTCATGTGATTTTGTGTTTGTGGACCATTAAATAAAGCCAAATAAATATAATTTATACCATAAATGCATTCATT
GCTCTAATCTGGTTATCACTGTTATATTCCTAACAACTTTATTTTATAGAAGCTTAAGTGAAAATGATACATGTTAGAAGACATGAAACA
AGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAAAGAAGTAGTATCTCACAATTACTTGAT
AGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGTTTTGAAAATGATGAAGAGCTTGATAGT
AACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATTCAAAGTGAAGGAAATGACAGTAAGTGT
CTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAATATTGACTTACAAGATCAGGAAAAACAT
TTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAAAAACATTTAAGTCAAGAGGATAATGAT
CTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGAAAAAGAAAAAGGCTATCCTCTGTGATG
TGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCCCGTAGAGTGGTTGAAGATGAAGGTTCT
TCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTTCAGAAGCTCAAAGAACTCTCAAAACAA
AGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCAAGCAGTGATGAAGTTGATGAGGAGGAA
GAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTGCAAGATGAGGAGGGTGATGAAGAGAAT
AAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTTTATTCTTTTAGTGACCACTATACTCAT
TTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTATATGATGGCACAAGGCAAAAATCATAT
GCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAGAGCTTGGTATCTAGAAGTCGTTGGAAA
GAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAACTTTGTGATACATACCCTGCCCTCCTG
GTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGCCGTATCCCAGTTTTATCATGGATTCAT
CCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGAAGCAAAGAAGATGAAAAATACCTTCAA
GCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTTAATGCTGTTGCCAACAAGGCAAAGGGT
GGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAATATTCATGTTATGAGAGAATCATTACGA
AAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCTACTCATTGGCTAGAACATATTAAGCTT
ATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTGCATTGCAGTGATGGTTGGGATCGCACA
GCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTA
AGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGACAGATCGCCTGTTTTTCTTCAATTTATT
GACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATTTTGGACCACCTATACAGC
TGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAAAGGACTGTGTCACTGTGGTCTTACATA
AACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTATCCAGTAGCCAGCATGCGCCACCTAGAG
CTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAACAGATACAAAGAACTTCTTGCTAAACGA
GCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCCTCAGAGAGAGCCAGCTCTCCTGCACAG
TGTGTCACTCCTGTCCAAACTGTTGTATAAAGGACTGTAAGATCAGGGGCATCATTGCTATACACTCTTGATTACACTGGCAGCTCTATG
AGTAGAAAGTCTTCGGAATTTAGAACCCATCTATGAGAGAAAGTTCAGTCACTTTATTTATTTTAAATCTCTCTAGGATGAGTTTAGAAC
TGTAGCAGTGCAGGTGGCTTAAGTGAAGTAACTCCATATGTAATTACATGATTATGATACTAATCTTTTAAGTATCCAAAGAATATTAAA
ATACTTCAATCCTGGATTCACAGTGGGAACAAGTTTCTATTAAAAGGCAAATGCTGTTACAAATTTTTGGCATCTGGTAATATTAAAACC
ATTTTAGAAATACACTCTGTGCTCACTGTGCAGAGGAACATCAGTTTTCAAACCAACACTGAAATTCTGTGGCATCACATATATTGGGCC
TTGATGTCATGACAGATCAAAATCATTTGATATCCCTTTCTCCATTCTAGGTTTTTCTTTTTTTCAGTAACTGATTTACCTTGATCACTT
TTCAACTTCCATATTCTTCATATAGTAAAAGGCAAAGTGTTGAAGATACTACGGTGTGGTAGTAGTTGAAAATTATTGCCGTCATTATTT
ACATACTTAAGACATATTAGCAAGTTGATCCAAAATGGGAGGCCTTATAGATGTGCTTGGGGGAAAATGAAGGGGAGAAAGTAGCCATAC
AGGAGTTCAAAGAATTCCATGCCCTTCAGATTAGCCCAATTACCAGAAACATCATGAAAGATATTTTAAAAACTAATTATTTACTACAGT
GTATTTCACTTGTCTTGTGTGTCTGAACACACAGAAGCTAATTAGCAAGTTTTTAAGAAGTATTTAAAAATCTTACTAGGATTGACATTT
TTTCTGAATTCTGTATAAATAGCTTATAGTGAGAAGTACTGTGCTCAAATTTTACATTTTTTTCCTTTGCAAATTCTGTAATTTCACTCA
ACGATTAAGTCTACCAAAGAACACACTGCATGTAAAAGATGTATTACAATCTCAAAGCCAGTAAAAGAAATCTTGCTTCACTGTTCACCT
GCTACAAGTAAGAGTTTGGTGCTGGTAGAAACATTTGACTCTGATGTCTATTTTATTCTACATAAGAGCCATATGTAATGTACTGTAACA
AAGGAGCTTCTTGTCCCCTTGGTCTTTTAATTAAAAGAAATTCCAACTGACTTTTAAACTTTGTTCTTGTCCAAAGTTGCCATTTCTTTT
TTTTCCCCAGAAATATTTGGAAATTATTGGAGGAATATGCACCCCAGATGAAAATGTTCAGTTTGTACCCATTTTTCCTTAACCAACACC
CAAATCAAACAATTAAAATATACAGTGTTTTTCCACTCACTAATTCACTATACAGAGAGTCTGAACCTTAGCCTCCCTCTTGGTCTTGCA
GTGAGGAAGTTTCTATTAGTATATCCAATTTAGCAAAATTGGTACCAAAATGATTTCTTTGGTAATTGTGTGAAATATAAGCTTTTTAAC
AGGGCATTTAAGTGGCTAGCAAATCAGTAATTAAAAATTAAGCTTTCTACTCCAAGTATTTCACAAACGCATCTGCCATTTTCCTCATTT
AAACCTTGGTTATCTTGGCCTGATACCACATAAAAGAATGTAGAATGGCTGAAGAGATCAAGAATTTAAAGCTTCTAGTCTTAACATACT
TGCATCCACTTCAAATTCAAATCAAAAGCCAGGGAAATCTAAGTGCAACCCTACCACTTCTCTGCTGAGAACCTTCCAGTGGTTCCCCTC
ACCTTCTGCAGAAGTCTCCAATATGGAGTACATGCACTTGGGCATTTAATATATACCACTGGTGTGTGTGGGAGGGAGGGAGGAGGAATA
CTAGCCCTTTTTATATATTTACACAAGCAAAACTTTTAAATATTTGAATTGACAGTTACATGTTTCATAACTTTGTATGTCTATTGGTTG
TGCAGGTGTAATTTTTTCCCTTTTTGATTAGGGTTACAAAATTTAGAGACCAGTATGATTAAGTTGAAGCTCCTTAGCCTCCTTCGACCT
AGTCTCTGCATACCTCAACTTTTACGTACCAATGCTACTCTGCTGTTCACAATTGCCTCATGTAATCTGCAGATTCCTGCCTCCCCACTT
TGGTTCAGTCTGTCTTGTGCACCTGGAACAACTGTTCTCCCTTGTGACTAATTCCTATTTTCTAGAGTTTAGGCATCATCTCTTCCTTTG
GGAAGTTATCTGATTCACGACTGCCTTCTCTGACATCCCCACCTTCCTCTGTGCCCCCATAGCACTGTGTATACCGCTACTACCACTGCA
ATTCACATTATATTGGAATGAACAATTCACATGTCTACCACAAGTCTGTAAACATAACCTTATTTGAAATGAATTGCAATAAAGCTCTGT

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000346299_chr11_95583913_-_5138nt
CAGCACAACATACAACGTAATTCAGAGTAGATGTTCATATAATTATTTCATGGGCATTCAGTAAATTATTTGTTAAATTAATGTTCTACC
ATCTTCACTCAGATATTTCATGTGATTTTGTGTTTGTGGACCATTAAATAAAGCCAAATAAATATAATTTATACCATAAATGCATTCATT
GCTCTAATCTGGTTATCACTGTTATATTCCTAACAACTTTATTTTATAGAAGCTTAAGTGAAAATGATACATGTTAGAAGACATGAAACA
AGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAAAGAAGTAGTATCTCACAATTACTTGAT
AGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGTTTTGAAAATGATGAAGAGCTTGATAGT
AACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATTCAAAGTGAAGGAAATGACAGTAAGTGT
CTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAATATTGACTTACAAGATCAGGAAAAACAT
TTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAAAAACATTTAAGTCAAGAGGATAATGAT
CTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGAAAAAGAAAAAGGCTATCCTCTGTGATG
TGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCCCGTAGAGTGGTTGAAGATGAAGGTTCT
TCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTTCAGAAGCTCAAAGAACTCTCAAAACAA
AGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCAAGCAGTGATGAAGTTGATGAGGAGGAA
GAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTGCAAGATGAGGAGGGTGATGAAGAGAAT
AAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTTTATTCTTTTAGTGACCACTATACTCAT
TTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTATATGATGGCACAAGGCAAAAATCATAT
GCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAGAGCTTGGTATCTAGAAGTCGTTGGAAA
GAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAACTTTGTGATACATACCCTGCCCTCCTG
GTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGCCGTATCCCAGTTTTATCATGGATTCAT
CCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGAAGCAAAGAAGATGAAAAATACCTTCAA
GCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTTAATGCTGTTGCCAACAAGGCAAAGGGT
GGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAATATTCATGTTATGAGAGAATCATTACGA
AAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCTACTCATTGGCTAGAACATATTAAGCTT
ATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTGCATTGCAGTGATGGTTGGGATCGCACA
GCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTA
AGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGACAGATCGCCTGTTTTTCTTCAATTTATT
GACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATTTTGGACCACCTATACAGC
TGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAAAGGACTGTGTCACTGTGGTCTTACATA
AACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTATCCAGTAGCCAGCATGCGCCACCTAGAG
CTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAACAGATACAAAGAACTTCTTGCTAAACGA
GCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCCTCAGAGAGAGCCAGCTCTCCTGCACAG
TGTGTCACTCCTGTCCAAACTGTTGTATAAAGGACTGTAAGATCAGGGGCATCATTGCTATACACTCTTGATTACACTGGCAGCTCTATG
AGTAGAAAGTCTTCGGAATTTAGAACCCATCTATGAGAGAAAGTTCAGTCACTTTATTTATTTTAAATCTCTCTAGGATGAGTTTAGAAC
TGTAGCAGTGCAGGTGGCTTAAGTGAAGTAACTCCATATGTAATTACATGATTATGATACTAATCTTTTAAGTATCCAAAGAATATTAAA
ATACTTCAATCCTGGATTCACAGTGGGAACAAGTTTCTATTAAAAGGCAAATGCTGTTACAAATTTTTGGCATCTGGTAATATTAAAACC
ATTTTAGAAATACACTCTGTGCTCACTGTGCAGAGGAACATCAGTTTTCAAACCAACACTGAAATTCTGTGGCATCACATATATTGGGCC
TTGATGTCATGACAGATCAAAATCATTTGATATCCCTTTCTCCATTCTAGGTTTTTCTTTTTTTCAGTAACTGATTTACCTTGATCACTT
TTCAACTTCCATATTCTTCATATAGTAAAAGGCAAAGTGTTGAAGATACTACGGTGTGGTAGTAGTTGAAAATTATTGCCGTCATTATTT
ACATACTTAAGACATATTAGCAAGTTGATCCAAAATGGGAGGCCTTATAGATGTGCTTGGGGGAAAATGAAGGGGAGAAAGTAGCCATAC
AGGAGTTCAAAGAATTCCATGCCCTTCAGATTAGCCCAATTACCAGAAACATCATGAAAGATATTTTAAAAACTAATTATTTACTACAGT
GTATTTCACTTGTCTTGTGTGTCTGAACACACAGAAGCTAATTAGCAAGTTTTTAAGAAGTATTTAAAAATCTTACTAGGATTGACATTT
TTTCTGAATTCTGTATAAATAGCTTATAGTGAGAAGTACTGTGCTCAAATTTTACATTTTTTTCCTTTGCAAATTCTGTAATTTCACTCA
ACGATTAAGTCTACCAAAGAACACACTGCATGTAAAAGATGTATTACAATCTCAAAGCCAGTAAAAGAAATCTTGCTTCACTGTTCACCT
GCTACAAGTAAGAGTTTGGTGCTGGTAGAAACATTTGACTCTGATGTCTATTTTATTCTACATAAGAGCCATATGTAATGTACTGTAACA
AAGGAGCTTCTTGTCCCCTTGGTCTTTTAATTAAAAGAAATTCCAACTGACTTTTAAACTTTGTTCTTGTCCAAAGTTGCCATTTCTTTT
TTTTCCCCAGAAATATTTGGAAATTATTGGAGGAATATGCACCCCAGATGAAAATGTTCAGTTTGTACCCATTTTTCCTTAACCAACACC
CAAATCAAACAATTAAAATATACAGTGTTTTTCCACTCACTAATTCACTATACAGAGAGTCTGAACCTTAGCCTCCCTCTTGGTCTTGCA
GTGAGGAAGTTTCTATTAGTATATCCAATTTAGCAAAATTGGTACCAAAATGATTTCTTTGGTAATTGTGTGAAATATAAGCTTTTTAAC
AGGGCATTTAAGTGGCTAGCAAATCAGTAATTAAAAATTAAGCTTTCTACTCCAAGTATTTCACAAACGCATCTGCCATTTTCCTCATTT
AAACCTTGGTTATCTTGGCCTGATACCACATAAAAGAATGTAGAATGGCTGAAGAGATCAAGAATTTAAAGCTTCTAGTCTTAACATACT
TGCATCCACTTCAAATTCAAATCAAAAGCCAGGGAAATCTAAGTGCAACCCTACCACTTCTCTGCTGAGAACCTTCCAGTGGTTCCCCTC
ACCTTCTGCAGAAGTCTCCAATATGGAGTACATGCACTTGGGCATTTAATATATACCACTGGTGTGTGTGGGAGGGAGGGAGGAGGAATA
CTAGCCCTTTTTATATATTTACACAAGCAAAACTTTTAAATATTTGAATTGACAGTTACATGTTTCATAACTTTGTATGTCTATTGGTTG
TGCAGGTGTAATTTTTTCCCTTTTTGATTAGGGTTACAAAATTTAGAGACCAGTATGATTAAGTTGAAGCTCCTTAGCCTCCTTCGACCT
AGTCTCTGCATACCTCAACTTTTACGTACCAATGCTACTCTGCTGTTCACAATTGCCTCATGTAATCTGCAGATTCCTGCCTCCCCACTT
TGGTTCAGTCTGTCTTGTGCACCTGGAACAACTGTTCTCCCTTGTGACTAATTCCTATTTTCTAGAGTTTAGGCATCATCTCTTCCTTTG
GGAAGTTATCTGATTCACGACTGCCTTCTCTGACATCCCCACCTTCCTCTGTGCCCCCATAGCACTGTGTATACCGCTACTACCACTGCA
ATTCACATTATATTGGAATGAACAATTCACATGTCTACCACAAGTCTGTAAACATAACCTTATTTGAAATGAATTGCAATAAAGCTCTGT

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000409459_chr11_95583913_-_3932nt
CAGCACAACATACAACGTAATTCAGAGTAGATGTTCATATAATTATTTCATGGGCATTCAGTAAATTATTTGTTAAATTAATGTTCTACC
ATCTTCACTCAGATATTTCATGTGATTTTGTGTTTGTGGACCATTAAATAAAGCCAAATAAATATAATTTATACCATAAATGCATTCATT
GCTCTAATCTGGTTATCACTGTTATATTCCTAACAACTTTATTTTATAGAAGCTTAAGTGAAAATGATACATGTTAGAAGACATGAAACA
AGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAAAGAAGTAGTATCTCACAATTACTTGAT
AGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGTTTTGAAAATGATGAAGAGCTTGATAGT
AACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATTCAAAGTGAAGGAAATGACAGTAAGTGT
CTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAATATTGACTTACAAGATCAGGAAAAACAT
TTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAAAAACATTTAAGTCAAGAGGATAATGAT
CTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGAAAAAGAAAAAGGCTATCCTCTGTGATG
TGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCCCGTAGAGTGGTTGAAGATGAAGGTTCT
TCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTTCAGAAGCTCAAAGAACTCTCAAAACAA
AGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCAAGCAGTGATGAAGTTGATGAGGAGGAA
GAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTGCAAGATGAGGAGGGTGATGAAGAGAAT
AAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTTTATTCTTTTAGTGACCACTATACTCAT
TTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTATATGATGGCACAAGGCAAAAATCATAT
GCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAGAGCTTGGTATCTAGAAGTCGTTGGAAA
GAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAACTTTGTGATACATACCCTGCCCTCCTG
GTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGCCGTATCCCAGTTTTATCATGGATTCAT
CCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGAAGCAAAGAAGATGAAAAATACCTTCAA
GCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTTAATGCTGTTGCCAACAAGGCAAAGGGT
GGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAATATTCATGTTATGAGAGAATCATTACGA
AAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCTACTCATTGGCTAGAACATATTAAGCTT
ATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTGCATTGCAGTGATGGTTGGGATCGCACA
GCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTA
AGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGACAGATCGCCTGTTTTTCTTCAATTTATT
GACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATTTTGGACCACCTATACAGC
TGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAAAGGACTGTGTCACTGTGGTCTTACATA
AACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTATCCAGTAGCCAGCATGCGCCACCTAGAG
CTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAACAGATACAAAGAACTTCTTGCTAAACGA
GCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCCTCAGAGAGAGCCAGCTCTCCTGCACAG
TGTGTCACTCCTGTCCAAACTGTTGTATAAAGGACTGTAAGATCAGGGGCATCATTGCTATACACTCTTGATTACACTGGCAGCTCTATG
AGTAGAAAGTCTTCGGAATTTAGAACCCATCTATGAGAGAAAGTTCAGTCACTTTATTTATTTTAAATCTCTCTAGGATGAGTTTAGAAC
TGTAGCAGTGCAGGTGGCTTAAGTGAAGTAACTCCATATGTAATTACATGATTATGATACTAATCTTTTAAGTATCCAAAGAATATTAAA
ATACTTCAATCCTGGATTCACAGTGGGAACAAGTTTCTATTAAAAGGCAAATGCTGTTACAAATTTTTGGCATCTGGTAATATTAAAACC
ATTTTAGAAATACACTCTGTGCTCACTGTGCAGAGGAACATCAGTTTTCAAACCAACACTGAAATTCTGTGGCATCACATATATTGGGCC
TTGATGTCATGACAGATCAAAATCATTTGATATCCCTTTCTCCATTCTAGGTTTTTCTTTTTTTCAGTAACTGATTTACCTTGATCACTT
TTCAACTTCCATATTCTTCATATAGTAAAAGGCAAAGTGTTGAAGATACTACGGTGTGGTAGTAGTTGAAAATTATTGCCGTCATTATTT
ACATACTTAAGACATATTAGCAAGTTGATCCAAAATGGGAGGCCTTATAGATGTGCTTGGGGGAAAATGAAGGGGAGAAAGTAGCCATAC
AGGAGTTCAAAGAATTCCATGCCCTTCAGATTAGCCCAATTACCAGAAACATCATGAAAGATATTTTAAAAACTAATTATTTACTACAGT
GTATTTCACTTGTCTTGTGTGTCTGAACACACAGAAGCTAATTAGCAAGTTTTTAAGAAGTATTTAAAAATCTTACTAGGATTGACATTT
TTTCTGAATTCTGTATAAATAGCTTATAGTGAGAAGTACTGTGCTCAAATTTTACATTTTTTTCCTTTGCAAATTCTGTAATTTCACTCA
ACGATTAAGTCTACCAAAGAACACACTGCATGTAAAAGATGTATTACAATCTCAAAGCCAGTAAAAGAAATCTTGCTTCACTGTTCACCT
GCTACAAGTAAGAGTTTGGTGCTGGTAGAAACATTTGACTCTGATGTCTATTTTATTCTACATAAGAGCCATATGTAATGTACTGTAACA

>In-frame_CCDC82_ENST00000423339_chr11_96104177_-_MTMR2_ENST00000352297_chr11_95583913_-_3931nt
CAGCACAACATACAACGTAATTCAGAGTAGATGTTCATATAATTATTTCATGGGCATTCAGTAAATTATTTGTTAAATTAATGTTCTACC
ATCTTCACTCAGATATTTCATGTGATTTTGTGTTTGTGGACCATTAAATAAAGCCAAATAAATATAATTTATACCATAAATGCATTCATT
GCTCTAATCTGGTTATCACTGTTATATTCCTAACAACTTTATTTTATAGAAGCTTAAGTGAAAATGATACATGTTAGAAGACATGAAACA
AGGAGAAATTCTAAGAGTCACGTGCCTGAGCAGAAATCTCGAGTTGATTGGAGGCGAACTAAAAGAAGTAGTATCTCACAATTACTTGAT
AGTGATGAAGAGCTTGATAGTGAAGAATTTGATAGTGATGAAGAGCTTGATAGTGATGAAAGTTTTGAAAATGATGAAGAGCTTGATAGT
AACAAGGGACCTGATTGTAATAAAACACCAGGAAGTGAAAGAGAGCTCAACTTAAGTAAAATTCAAAGTGAAGGAAATGACAGTAAGTGT
CTCATTAACTCTGGCAACGGTTCAACATATGAAGAAGAAACGAACAAAATCAAACATAGGAATATTGACTTACAAGATCAGGAAAAACAT
TTAAGTCAAGAGGATAATGATCTCAACAAACAAACTGGACAAATAATAGAGGATGATCAGGAAAAACATTTAAGTCAAGAGGATAATGAT
CTCAACAAACAAACTGGACAAATAATAGAGGATGATTTAGAAGAAGAAGACATCAAGCGAGGAAAAAGAAAAAGGCTATCCTCTGTGATG
TGTGACAGTGATGAGAGTGATGACAGCGATATCCTAGTTAGAAAAGTAGGTGTTAAACGTCCCCGTAGAGTGGTTGAAGATGAAGGTTCT
TCAGTGGAAATGGAGCAAAAGACTCCTGAAAAAACATTAGCTGCACAAAAGCGAGAAAAACTTCAGAAGCTCAAAGAACTCTCAAAACAA
AGATCTCGTCAGAGACGCAGTAGTGGTAGAGATTTTGAGGACTCTGAAAAGGAATCTTGCCCAAGCAGTGATGAAGTTGATGAGGAGGAA
GAAGAGGATAATTATGAATCTGATGAAGATGGAGATGATTATATTATCGATGACTTTGTAGTGCAAGATGAGGAGGGTGATGAAGAGAAT
AAAAACCAACAAGGAGAAAAATTGACTACATCACAACTGAAATTAGTAAAACAGAATTCTCTTTATTCTTTTAGTGACCACTATACTCAT
TTTGAAAGAGTTGTGAAGGCTCTTCTGATCAACGCTTTAGATGAATCTTTTCTGGGAACATTATATGATGGCACAAGGCAAAAATCATAT
GCAAAAGATATGCTAACATCTCTTCATTATTTGGATAACCGCTTTGTTCAGCCTCGTCTAGAGAGCTTGGTATCTAGAAGTCGTTGGAAA
GAGCAATATAAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGATATGAACTTTGTGATACATACCCTGCCCTCCTG
GTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAGAGTGGCATCCTTCAGATCAAGAGGCCGTATCCCAGTTTTATCATGGATTCAT
CCTGAAAGTCAAGCCACAATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGAAGCAAAGAAGATGAAAAATACCTTCAA
GCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTTAATGCTGTTGCCAACAAGGCAAAGGGT
GGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTCCTGGATATCCACAATATTCATGTTATGAGAGAATCATTACGA
AAACTTAAGGAGATTGTGTACCCCAACATTGAGGAAACCCACTGGTTGTCTAACTTGGAATCTACTCATTGGCTAGAACATATTAAGCTT
ATTCTTGCAGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTGCATTGCAGTGATGGTTGGGATCGCACA
GCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAGGATTTGAAGTCCTTGTGGAGAAAGAATGGCTA
AGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGGAGATAAGAACCATGCAGATGCAGACAGATCGCCTGTTTTTCTTCAATTTATT
GACTGTGTCTGGCAGATGACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATTTTGGACCACCTATACAGC
TGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAAAGGACTGTGTCACTGTGGTCTTACATA
AACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCCAATCATGTCCTTTATCCAGTAGCCAGCATGCGCCACCTAGAG
CTCTGGGTGGGATATTACATAAGGTGGAATCCACGGATGAAACCACAGGAACCTATTCACAACAGATACAAAGAACTTCTTGCTAAACGA
GCAGAGCTTCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCCTCAGAGAGAGCCAGCTCTCCTGCACAG
TGTGTCACTCCTGTCCAAACTGTTGTATAAAGGACTGTAAGATCAGGGGCATCATTGCTATACACTCTTGATTACACTGGCAGCTCTATG
AGTAGAAAGTCTTCGGAATTTAGAACCCATCTATGAGAGAAAGTTCAGTCACTTTATTTATTTTAAATCTCTCTAGGATGAGTTTAGAAC
TGTAGCAGTGCAGGTGGCTTAAGTGAAGTAACTCCATATGTAATTACATGATTATGATACTAATCTTTTAAGTATCCAAAGAATATTAAA
ATACTTCAATCCTGGATTCACAGTGGGAACAAGTTTCTATTAAAAGGCAAATGCTGTTACAAATTTTTGGCATCTGGTAATATTAAAACC
ATTTTAGAAATACACTCTGTGCTCACTGTGCAGAGGAACATCAGTTTTCAAACCAACACTGAAATTCTGTGGCATCACATATATTGGGCC
TTGATGTCATGACAGATCAAAATCATTTGATATCCCTTTCTCCATTCTAGGTTTTTCTTTTTTTCAGTAACTGATTTACCTTGATCACTT
TTCAACTTCCATATTCTTCATATAGTAAAAGGCAAAGTGTTGAAGATACTACGGTGTGGTAGTAGTTGAAAATTATTGCCGTCATTATTT
ACATACTTAAGACATATTAGCAAGTTGATCCAAAATGGGAGGCCTTATAGATGTGCTTGGGGGAAAATGAAGGGGAGAAAGTAGCCATAC
AGGAGTTCAAAGAATTCCATGCCCTTCAGATTAGCCCAATTACCAGAAACATCATGAAAGATATTTTAAAAACTAATTATTTACTACAGT
GTATTTCACTTGTCTTGTGTGTCTGAACACACAGAAGCTAATTAGCAAGTTTTTAAGAAGTATTTAAAAATCTTACTAGGATTGACATTT
TTTCTGAATTCTGTATAAATAGCTTATAGTGAGAAGTACTGTGCTCAAATTTTACATTTTTTTCCTTTGCAAATTCTGTAATTTCACTCA
ACGATTAAGTCTACCAAAGAACACACTGCATGTAAAAGATGTATTACAATCTCAAAGCCAGTAAAAGAAATCTTGCTTCACTGTTCACCT
GCTACAAGTAAGAGTTTGGTGCTGGTAGAAACATTTGACTCTGATGTCTATTTTATTCTACATAAGAGCCATATGTAATGTACTGTAACA


Top

FusionGenePPI for CCDC82_MTMR2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CCDC82VHL, MARK2, MED12, TINF2, COPS7A, NETO2, CCDC101, SERPINB5, PKP3, PKP1, TOMM34, TRIM29, CALML3, IGKC, LY6G6C, TF, ALBMTMR2SBF1, MTMR2, ELAVL1, RFC5, SNTA1, HSF1, SZRD1, CTPS2, EHD4, LRSAM1, PLIN3, XPNPEP1, UNK, MTMR11, CCDC22, MTMR1, MTMR10, MTMR12, NFKB1, SBF2, TUBA1B, MTMR9, EYA3, SEPSECS, NUDT16, GADD45GIP1, RPS19BP1, MRTO4, EBNA1BP2, RPL3L, ERBB4, ERBB3, ROR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CCDC82_MTMR2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CCDC82_MTMR2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMTMR2C1832399Charcot-Marie-Tooth disease, Type 4B11CTD_human;ORPHANET;UNIPROT