FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5690

FusionGeneSummary for CBL_CXCR5

check button Fusion gene summary
Fusion gene informationFusion gene name: CBL_CXCR5
Fusion gene ID: 5690
HgeneTgene
Gene symbol

CBL

CXCR5

Gene ID

867

643

Gene nameCbl proto-oncogeneC-X-C motif chemokine receptor 5
SynonymsC-CBL|CBL2|FRA11B|NSLL|RNF55BLR1|CD185|MDR15
Cytomap

11q23.3

11q23.3

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase CBLCas-Br-M (murine) ecotropic retroviral transforming sequenceCbl proto-oncogene, E3 ubiquitin protein ligaseRING finger protein 55RING-type E3 ubiquitin transferase CBLcasitas B-lineage lymphoma proto-oncogenefragile siC-X-C chemokine receptor type 5Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5)Burkitt lymphoma receptor 1, GTP-binding proteinCXC-R5CXCR-5MDR-15chemokine (C-X-C motif) receptor 5monocyte-derived receptor 15
Modification date2018052320180527
UniProtAcc

P22681

P32302

Ensembl transtripts involved in fusion geneENST00000264033, ENST00000292174, 
Fusion gene scores* DoF score10 X 7 X 7=49011 X 3 X 7=231
# samples 1111
** MAII scorelog2(11/490*10)=-2.15527822547791
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/231*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CBL [Title/Abstract] AND CXCR5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-J9-A8CL-01ACBLchr11

119103405

+CXCR5chr11

118764305

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264033ENST00000292174CBLchr11

119103405

+CXCR5chr11

118764305

+

Top

FusionProtFeatures for CBL_CXCR5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CBL

P22681

CXCR5

P32302

Adapter protein that functions as a negative regulatorof many signaling pathways that are triggered by activation ofcell surface receptors. Acts as an E3 ubiquitin-protein ligase,which accepts ubiquitin from specific E2 ubiquitin-conjugatingenzymes, and then transfers it to substrates promoting theirdegradation by the proteasome. Recognizes activated receptortyrosine kinases, including KIT, FLT1, FGFR1, FGFR2, PDGFRA,PDGFRB, EGFR, CSF1R, EPHA8 and KDR and terminates signaling.Recognizes membrane-bound HCK, SRC and other kinases of the SRCfamily and mediates their ubiquitination and degradation.Participates in signal transduction in hematopoietic cells. Playsan important role in the regulation of osteoblast differentiationand apoptosis. Essential for osteoclastic bone resorption. The'Tyr-731' phosphorylated form induces the activation andrecruitment of phosphatidylinositol 3-kinase to the cell membranein a signaling pathway that is critical for osteoclast function.May be functionally coupled with the E2 ubiquitin-protein ligaseUB2D3. {ECO:0000269|PubMed:10514377, ECO:0000269|PubMed:11896602,ECO:0000269|PubMed:14661060, ECO:0000269|PubMed:14739300,ECO:0000269|PubMed:15190072, ECO:0000269|PubMed:17509076,ECO:0000269|PubMed:18374639, ECO:0000269|PubMed:19689429,ECO:0000269|PubMed:21596750}. Cytokine receptor that binds to B-lymphocytechemoattractant (BLC). Involved in B-cell migration into B-cellfollicles of spleen and Peyer patches but not into those ofmesenteric or peripheral lymph nodes. May have a regulatoryfunction in Burkitt lymphoma (BL) lymphomagenesis and/or B-celldifferentiation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02110_12417373Topological domainExtracellular
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02146_16717373Topological domainCytoplasmic
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02189_21917373Topological domainExtracellular
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02241_25917373Topological domainCytoplasmic
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02281_30417373Topological domainExtracellular
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02326_37217373Topological domainCytoplasmic
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+0277_8817373Topological domainCytoplasmic
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02125_14517373TransmembraneHelical%3B Name%3D3
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02168_18817373TransmembraneHelical%3B Name%3D4
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02220_24017373TransmembraneHelical%3B Name%3D5
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02260_28017373TransmembraneHelical%3B Name%3D6
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+02305_32517373TransmembraneHelical%3B Name%3D7
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+0256_7617373TransmembraneHelical%3B Name%3D1
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+0289_10917373TransmembraneHelical%3B Name%3D2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216227_240147907Calcium binding.
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216357_476147907Compositional biasNote=Asp/Glu-rich (acidic)
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216477_688147907Compositional biasNote=Pro-rich
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216689_834147907Compositional biasNote=Asp/Glu-rich (acidic)
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+21647_351147907DomainCbl-PTB
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216856_895147907DomainUBA
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216176_248147907RegionNote=EF-hand-like
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216249_351147907RegionNote=SH2-like
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216352_380147907RegionNote=Linker
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+21647_175147907RegionNote=4H
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216381_420147907Zinc fingerRING-type
TgeneCXCR5chr11:119103405chr11:118764305ENST00000292174+021_5517373Topological domainExtracellular


Top

FusionGeneSequence for CBL_CXCR5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CBL_ENST00000264033_chr11_119103405_+_CXCR5_ENST00000292174_chr11_118764305_+_503aa
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPD
TYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPSSGNWTDWTTITTPPWWKIISALPQRGPSWPPS
RPCSCPWPTASSSSWAXSATSWCWXSWSGTGRHAVPRRPSCSTWPWPTSCWSSSCPLPWPRALWAGSWGPSSAKLXLPCTKSTSTAAACS
WPASPWTATWPLSTPSMPTATAASSPSTSPVGPSGWWASSLPCQRFSSPKSAKAITTTPCHVAPSPKRTKQKRMPGSPPDSSTMWRDSCC
PCWXWAGATWGXCTGCARPSGALSGRRQSGWPSWXQASSSSAGHPTTSSSSWTPWRGXRPWTIPASXMALSPWPSPCVSSWAWPTAASTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CBL_ENST00000264033_chr11_119103405_+_CXCR5_ENST00000292174_chr11_118764305_+_1511nt
ATGGCCGGCAACGTGAAGAAGAGCTCTGGGGCCGGGGGCGGCAGCGGCTCCGGGGGCTCGGGTTCGGGTGGCCTGATTGGGCTCATGAAG
GACGCCTTCCAGCCGCACCACCACCACCACCACCACCTCAGCCCCCACCCGCCGGGGACGGTGGACAAGAAGATGGTGGAGAAGTGCTGG
AAGCTCATGGACAAGGTGGTGCGGTTGTGTCAGAACCCAAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTTAGACCTGCTACCAGAT
ACCTACCAGCATCTCCGTACTATCTTGTCAAGATATGAGGGGAAGATGGAGACACTTGGAGAAAATGAGTATTTTAGGGTGTTTATGGAG
AATTTGATGAAGAAAACTAAGCAAACCATAAGCCTCTTCAAGGAGGGAAAAGAAAGAATGTATGAGGAGAATTCTCAGCCTAGTTCTGGG
AACTGGACAGATTGGACAACTATAACGACACCTCCCTGGTGGAAAATCATCTCTGCCCTGCCACAGAGGGGCCCCTCATGGCCTCCTTCA
AGGCCGTGTTCGTGCCCGTGGCCTACAGCCTCATCTTCCTCCTGGGCGTGATCGGCAACGTCCTGGTGCTGGTGATCCTGGAGCGGCACC
GGCAGACACGCAGTTCCACGGAGACCTTCCTGTTCCACCTGGCCGTGGCCGACCTCCTGCTGGTCTTCATCTTGCCCTTTGCCGTGGCCG
AGGGCTCTGTGGGCTGGGTCCTGGGGACCTTCCTCTGCAAAACTGTGATTGCCCTGCACAAAGTCAACTTCTACTGCAGCAGCCTGCTCC
TGGCCTGCATCGCCGTGGACCGCTACCTGGCCATTGTCCACGCCGTCCATGCCTACCGCCACCGCCGCCTCCTCTCCATCCACATCACCT
GTGGGACCATCTGGCTGGTGGGCTTCCTCCTTGCCTTGCCAGAGATTCTCTTCGCCAAAGTCAGCCAAGGCCATCACAACAACTCCCTGC
CACGTTGCACCTTCTCCCAAGAGAACCAAGCAGAAACGCATGCCTGGTTCACCTCCCGATTCCTCTACCATGTGGCGGGATTCCTGCTGC
CCATGCTGGTGATGGGCTGGTGCTACGTGGGGGTAGTGCACAGGTTGCGCCAGGCCCAGCGGCGCCCTCAGCGGCAGAAGGCAGTCAGGG
TGGCCATCCTGGTGACAAGCATCTTCTTCCTCTGCTGGTCACCCTACCACATCGTCATCTTCCTGGACACCCTGGCGAGGCTGAAGGCCG
TGGACAATACCTGCAAGCTGAATGGCTCTCTCCCCGTGGCCATCACCATGTGTGAGTTCCTGGGCCTGGCCCACTGCTGCCTCAACCCCA
TGCTCTACACTTTCGCCGGCGTGAAGTTCCGCAGTGACCTGTCGCGGCTCCTGACGAAGCTGGGCTGTACCGGCCCTGCCTCCCTGTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CBL_ENST00000264033_chr11_119103405_+_CXCR5_ENST00000292174_chr11_118764305_+_5023nt
ACAGAAACCTGGCCGCGGCTTTCCGGGAGCTGTGGGCACGCGAGCTGCTCGAAGCCGGTGGCCCGGGGATCGTCGCTGCCCAGTCCGGCC
GCGGCCGGCCGCTTCCCCGAGCTTACCAGTAAGCCGGTCCGCCTCCGGGACGCGCCCCGCCCGCCCCGGGCTCGCGCGCTCTGAAGGGGC
GCGTCCCGCGCACTCCCGGCGCCGCCCACTCCCCTCCCCACGGCCGCTCCTCCCTCCGCCCGGATAGCCGGCGGCGGCGGCGGCGGCGGC
GGCGGCGGCGGCCGGGAGAGGCCCCTCCTTCACGCCCTGCTTCTCTCCCTCGCTCGCAGTCGAGCCGAGCCGGCGGACCCGCCTGGGCTC
CGACCCTGCCCAGGCCATGGCCGGCAACGTGAAGAAGAGCTCTGGGGCCGGGGGCGGCAGCGGCTCCGGGGGCTCGGGTTCGGGTGGCCT
GATTGGGCTCATGAAGGACGCCTTCCAGCCGCACCACCACCACCACCACCACCTCAGCCCCCACCCGCCGGGGACGGTGGACAAGAAGAT
GGTGGAGAAGTGCTGGAAGCTCATGGACAAGGTGGTGCGGTTGTGTCAGAACCCAAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTT
AGACCTGCTACCAGATACCTACCAGCATCTCCGTACTATCTTGTCAAGATATGAGGGGAAGATGGAGACACTTGGAGAAAATGAGTATTT
TAGGGTGTTTATGGAGAATTTGATGAAGAAAACTAAGCAAACCATAAGCCTCTTCAAGGAGGGAAAAGAAAGAATGTATGAGGAGAATTC
TCAGCCTAGTTCTGGGAACTGGACAGATTGGACAACTATAACGACACCTCCCTGGTGGAAAATCATCTCTGCCCTGCCACAGAGGGGCCC
CTCATGGCCTCCTTCAAGGCCGTGTTCGTGCCCGTGGCCTACAGCCTCATCTTCCTCCTGGGCGTGATCGGCAACGTCCTGGTGCTGGTG
ATCCTGGAGCGGCACCGGCAGACACGCAGTTCCACGGAGACCTTCCTGTTCCACCTGGCCGTGGCCGACCTCCTGCTGGTCTTCATCTTG
CCCTTTGCCGTGGCCGAGGGCTCTGTGGGCTGGGTCCTGGGGACCTTCCTCTGCAAAACTGTGATTGCCCTGCACAAAGTCAACTTCTAC
TGCAGCAGCCTGCTCCTGGCCTGCATCGCCGTGGACCGCTACCTGGCCATTGTCCACGCCGTCCATGCCTACCGCCACCGCCGCCTCCTC
TCCATCCACATCACCTGTGGGACCATCTGGCTGGTGGGCTTCCTCCTTGCCTTGCCAGAGATTCTCTTCGCCAAAGTCAGCCAAGGCCAT
CACAACAACTCCCTGCCACGTTGCACCTTCTCCCAAGAGAACCAAGCAGAAACGCATGCCTGGTTCACCTCCCGATTCCTCTACCATGTG
GCGGGATTCCTGCTGCCCATGCTGGTGATGGGCTGGTGCTACGTGGGGGTAGTGCACAGGTTGCGCCAGGCCCAGCGGCGCCCTCAGCGG
CAGAAGGCAGTCAGGGTGGCCATCCTGGTGACAAGCATCTTCTTCCTCTGCTGGTCACCCTACCACATCGTCATCTTCCTGGACACCCTG
GCGAGGCTGAAGGCCGTGGACAATACCTGCAAGCTGAATGGCTCTCTCCCCGTGGCCATCACCATGTGTGAGTTCCTGGGCCTGGCCCAC
TGCTGCCTCAACCCCATGCTCTACACTTTCGCCGGCGTGAAGTTCCGCAGTGACCTGTCGCGGCTCCTGACGAAGCTGGGCTGTACCGGC
CCTGCCTCCCTGTGCCAGCTCTTCCCTAGCTGGCGCAGGAGCAGTCTCTCTGAGTCAGAGAATGCCACCTCTCTCACCACGTTCTAGGTC
CCAGTGTCCCCTTTTATTGCTGCTTTTCCTTGGGGCAGGCAGTGATGCTGGATGCTCCTTCCAACAGGAGCTGGGATCCTAAGGGCTCAC
CGTGGCTAAGAGTGTCCTAGGAGTATCCTCATTTGGGGTAGCTAGAGGAACCAACCCCCATTTCTAGAACATCCCTGCCAGCTCTTCTGC
CGGCCCTGGGGCTAGGCTGGAGCCCAGGGAGCGGAAAGCAGCTCAAAGGCACAGTGAAGGCTGTCCTTACCCATCTGCACCCCCCTGGGC
TGAGAGAACCTCACGCACCTCCCATCCTAATCATCCAATGCTCAAGAAACAACTTCTACTTCTGCCCTTGCCAACGGAGAGCGCCTGCCC
CTCCCAGAACACACTCCATCAGCTTAGGGGCTGCTGACCTCCACAGCTTCCCCTCTCTCCTCCTGCCCACCTGTCAAACAAAGCCAGAAG
CTGAGCACCAGGGGATGAGTGGAGGTTAAGGCTGAGGAAAGGCCAGCTGGCAGCAGAGTGTGGCCTTCGGACAACTCAGTCCCTAAAAAC
ACAGACATTCTGCCAGGCCCCCAAGCCTGCAGTCATCTTGACCAAGCAGGAAGCTCAGACTGGTTGAGTTCAGGTAGCTGCCCCTGGCTC
TGACCGAAACAGCGCTGGGTCCACCCCATGTCACCGGATCCTGGGTGGTCTGCAGGCAGGGCTGACTCTAGGTGCCCTTGGAGGCCAGCC
AGTGACCTGAGGAAGCGTGAAGGCCGAGAAGCAAGAAAGAAACCCGACAGAGGGAAGAAAAGAGCTTTCTTCCCGAACCCCAAGGAGGGA
GATGGATCAATCAAACCCGGCGGTCCCCTCCGCCAGGCGAGATGGGGTGGGGTGGAGAACTCCTAGGGTGGCTGGGTCCAGGGGATGGGA
GGTTGTGGGCATTGATGGGGAAGGAGGCTGGCTTGTCCCCTCCTCACTCCCTTCCCATAAGCTATAGACCCGAGGAAACTCAGAGTCGGA
ACGGAGAAAGGTGGACTGGAAGGGGCCCGTGGGAGTCATCTCAACCATCCCCTCCGTGGCATCACCTTAGGCAGGGAAGTGTAAGAAACA
CACTGAGGCAGGGAAGTCCCCAGGCCCCAGGAAGCCGTGCCCTGCCCCCGTGAGGATGTCACTCAGATGGAACCGCAGGAAGCTGCTCCG
TGCTTGTTTGCTCACCTGGGGTGTGGGAGGCCCGTCCGGCAGTTCTGGGTGCTCCCTACCACCTCCCCAGCCTTTGATCAGGTGGGGAGT
CAGGGACCCCTGCCCTTGTCCCACTCAAGCCAAGCAGCCAAGCTCCTTGGGAGGCCCCACTGGGGAAATAACAGCTGTGGCTCACGTGAG
AGTGTCTTCACGGCAGGACAACGAGGAAGCCCTAAGACGTCCCTTTTTTCTCTGAGTATCTCCTCGCAAGCTGGGTAATCGATGGGGGAG
TCTGAAGCAGATGCAAAGAGGCAAGAGGCTGGATTTTGAATTTTCTTTTTAATAAAAAGGCACCTATAAAACAGGTCAATACAGTACAGG
CAGCACAGAGACCCCCGGAACAAGCCTAAAAATTGTTTCAAAATAAAAACCAAGAAGATGTCTTCACATATTGTATTTATATATTTATAT
TTATATATATATTTATATAATGGTACAAAATGGCTGGGGGTGTGGCCATGGATGGAGGGAAGAGTAGGCTGGCCTGTGGCGTGGGTGGGA
GGAGAGGGGACGGAGAGGGCACTCGGCCCGCTGCAATCTGACCCCTCTCTCCTCAGGGCAGGAAACACAGAGTCAGACAGTTTGGGGGGG
TCTTGGGCCAGGGGTGGAGGGCTCAAGGGCACAGGGCCCAGGCTGAGGCAGGGCGGGCAAAGCGCCTGGCAGGATGAAGGGCAAGTGGCC
CCCCAAACACAGAGGCCCTGGCCATGGACCCTGGGAGGTGACCGGGGTGAGTCAGGGGCCTGTTGTCAGCCCCAGAGGAAGCGCTGGACC
TGGCCGATGGTGGGCCGAGAGGACAGCACCAGGCTGGGAGAAGTGGGGCGAGTTCCCTTTGTATTACAGCTGCCAGTGCAAGACCAGGCC
CTCCAGGCCAGGAAGGCTAGGGACGGGTCCTGGTAGAAGACACCCTGTCTAGAATGGCCCTTGGTCCTGGAGGTGGGGCGCAAAAGGCCT
CAGCCAGGGAACTGCCCTGCCACCTCCCGAGGCAGGAAAGGAAGTGAGAAAAGGAGAAGTTTTTTTACTCCTGGGGCCAAAGTAGGGGGA
CAAACACCCAGTCGTATATGGCTTCAGCTCTGACCAAAGGCGGATAGGGAGCTCTCCTGGGTAGGAGCAGGGAGCCAAGGGGGAGGCAGT
GGCTGTGCCTGGGTGGGCACAGACAGATCTGGTACATGGCCCTGAGCCCTGGGCAGAGGGACAACCTTGCCGGTGAGTGGGCAGGCAGAG
AGGAGGCGGCAGGATGCTGTTTCCCCGATTCCATCCTCAGGGAGTGGAGACTGGAGGGGAGGTGCACTGACTCAGATGAACTGTTCTCCC
CCTTCTTTGATAAGAAGTAGGTGGCAGCAGCCTCTGGAAAAGTCAGGGCCCTGGAGGTTACCTGGCCCAGGGCTACTACAGCCACAGGCC
CCAGTGGCACCATGCCACCCCTTCCATGGCTCCACTCAAGGGGGCCACACAGCCACCGCCTCTTCCTCCTTTCCTTCATCCCAAACTGGG
ACAAAAGACTTCAAGTTCTGGCTAAGATGTAGCAGCAGCGGATGCCCGGGCATCCAAAGTGGAAAGCCAGGGCCCCGTGTCACCGGTGTG
GGCAAACACACATGCACGTGCACACATGTTCTCCCTGAATCACTCAGCAGCAGACAGGCTGCCGCCCTGGGGGTCTCAGCCCTGCTAGGG
CTCACCAGGTGGAAGCCTAGGTGGTCTGACCTCAGTTTAGGAGTGGGTCATTTACGTCATCTTACCATTTGGGGACGAGACAGGAATGGT
ATCCCTTAGGGACCCAGAGACACTGCAAACAGTGGGTGGCCATGTAGGGCTGCATGTCCCTGGGTCCAGGGGAATGGAGGGAGCAATAAC


Top

FusionGenePPI for CBL_CXCR5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CBLKRT18, MYO1C, ZAP70, PDGFRA, CRKL, GRB2, ARHGEF7, HCK, PTK2B, SORBS2, SORBS1, CD2AP, SH2B2, SH3KBP1, PIK3R2, YWHAQ, SLA, SH3BP2, EGFR, PTPN6, LCK, SPRY2, CSF1R, SH3GL3, MET, SYK, FRS2, UBE2L3, BTK, LYN, FYN, TYK2, YWHAB, YWHAZ, VAV1, LCP2, UBE2D2, FGR, ABL1, SLA2, INPPL1, SHC1, NCK1, PLCG1, SH3GL2, FLOT1, PIK3R1, CRK, CSK, ITK, CD5, LTK, IGF1R, PTPN11, UBE2D1, SPRY4, UBC, CBL, CSF1, GAPVD1, KDR, ITSN1, MST1R, UBE2M, AXL, ITGA5, KIT, LRIG1, UBASH3A, UBASH3B, GAPDH, EEF1A1, CDC42, SRC, NOTCH1, CD247, STAP2, TNFRSF10A, TNFRSF10B, FCGR2A, MYH9, ACTA1, ACTB, ACTG2, VIM, HSPA4, HSPA5, EPHA8, UBE4B, EPHB1, IL7R, CD33, NTRK1, CFTR, PSMC5, ITCH, TEK, BAG1, PTK2, PXN, VAV2, IRF8, RET, IRS1, ITSN2, HRAS, DBNL, ASAP1, TNFRSF1A, MAPK14, MAPK8, BLNK, INPP5D, TUBB, TUBA1A, SOS1, NOTCH3, SMAD3, CALM1, YES1, SFN, YWHAH, YWHAE, EPHA2, RAPGEF1, ABI1, GIF, TCN1, TCN2, MYH2, HTR2A, FYB, FGFR2, GBA, SORBS3, ITGAV, BCAR1, CD38, BCR, OSTF1, GRAP2, PIK3CA, CD40, BLK, SYNM, CUBN, SPRY1, LAT, SNX18, KRT10, KRT1, KRT2, HSPA8, PIK3CB, SPTBN1, KRT6C, KRT6B, KRT9, KRT14, KRT5, ACACA, KRT16, TUBB4B, KRT6A, TUBA1C, HSPA9, HSPA1L, MYH10, IQGAP1, KRT17, HSPA1B, SPTA1, SPTAN1, HSPA6, CCT8, KRT79, RPS19, CBLB, KRT84, CORO1C, TRIM21, KRT3, TUBA4B, CAD, ACTN1, POP1, PRKCA, PRKCQ, MAP3K11, EPOR, UBE2D3, TRPV1, USP21, PTPN22, ITGA4, STAT5A, PTEN, TNS4, CTNNB1, WAS, TRAF4, TRIM8, IRF1, FLT3, LOX, NCK2, ERBB2, CAPZA1, PRPSAP2, ERBB4, SIRT2, FRS3, FLT1, TGFBR2, SSFA2, SMAD7, PIK3R3, APPL1, EPS8, STAT3, MZF1, SERPINA5, CEP170, CEP128, FBF1, NPHP1, XPO1, PSMC1, XRCC5, ERBB2IP, SP7, ARHGEF6, TGM2, TSG101, IRF3, CDH1, RAB39B, TRIM25, TRAF2CXCR5CXCR4, GNB3, GNG8, GNAI2, GNA11, GNA13


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCBLchr11:119103405chr11:118764305ENST00000264033+216648_906147907CD2AP


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CBL_CXCR5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CBL_CXCR5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCBLC0349639Juvenile Myelomonocytic Leukemia3CTD_human;HPO;ORPHANET
HgeneCBLC0008073Developmental Disabilities1CTD_human
HgeneCBLC0010417Cryptorchidism1CTD_human;HPO
HgeneCBLC0018273Growth Disorders1CTD_human
HgeneCBLC0042384Vasculitis1CTD_human
HgeneCBLC3150803NOONAN SYNDROME-LIKE DISORDER WITH OR WITHOUT JUVENILE MYELOMONOCYTIC LEUKEMIA1CTD_human;ORPHANET;UNIPROT
TgeneCXCR5C0023892Biliary cirrhosis1CTD_human