FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5643

FusionGeneSummary for CATSPERG_RASSF1

check button Fusion gene summary
Fusion gene informationFusion gene name: CATSPERG_RASSF1
Fusion gene ID: 5643
HgeneTgene
Gene symbol

CATSPERG

RASSF1

Gene ID

57828

11186

Gene namecation channel sperm associated auxiliary subunit gammaRas association domain family member 1
SynonymsC19orf15123F2|NORE2A|RASSF1A|RDA32|REH3P21
Cytomap

19q13.2

3p21.31

Type of geneprotein-codingprotein-coding
Descriptioncation channel sperm-associated protein subunit gammacatsper channel auxiliary subunit gammaras association domain-containing protein 1Ras association (RalGDS/AF-6) domain family member 1WUGSC:H_LUCA12.5cardiac-specific ras association domain family 1 proteinpancreas-specific ras association domain family 1 proteintumor suppressor protein R
Modification date2018052220180519
UniProtAcc

Q6ZRH7

Q9NS23

Ensembl transtripts involved in fusion geneENST00000409235, ENST00000410018, 
ENST00000215069, ENST00000467739, 
ENST00000327761, ENST00000395126, 
ENST00000357043, ENST00000359365, 
ENST00000488024, 
Fusion gene scores* DoF score1 X 1 X 1=12 X 1 X 2=4
# samples 12
** MAII scorelog2(1/1*10)=3.32192809488736log2(2/4*10)=2.32192809488736
Context

PubMed: CATSPERG [Title/Abstract] AND RASSF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRASSF1

GO:0007265

Ras protein signal transduction

15109305


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVMESOTCGA-SH-A7BD-01ACATSPERGchr19

38828144

+RASSF1chr3

50369585

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000409235ENST00000327761CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000409235ENST00000395126CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000409235ENST00000357043CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000409235ENST00000359365CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-intronENST00000409235ENST00000488024CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
In-frameENST00000410018ENST00000327761CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000410018ENST00000395126CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000410018ENST00000357043CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000410018ENST00000359365CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-intronENST00000410018ENST00000488024CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
In-frameENST00000215069ENST00000327761CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000215069ENST00000395126CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000215069ENST00000357043CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-5UTRENST00000215069ENST00000359365CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
5CDS-intronENST00000215069ENST00000488024CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
intron-3CDSENST00000467739ENST00000327761CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
intron-5UTRENST00000467739ENST00000395126CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
intron-5UTRENST00000467739ENST00000357043CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
intron-5UTRENST00000467739ENST00000359365CATSPERGchr19

38828144

+RASSF1chr3

50369585

-
intron-intronENST00000467739ENST00000488024CATSPERGchr19

38828144

+RASSF1chr3

50369585

-

Top

FusionProtFeatures for CATSPERG_RASSF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CATSPERG

Q6ZRH7

RASSF1

Q9NS23

Probably involved in sperm cell hyperactivation via itsassociation with CATSPER1. Sperm cell hyperactivation is neededfor sperm motility which is essential late in the preparation ofsperm for fertilization. {ECO:0000250|UniProtKB:C6KI89}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRASSF1chr19:38828144chr3:50369585ENST00000327761-05198_29249271DomainRas-associating
TgeneRASSF1chr19:38828144chr3:50369585ENST00000327761-05294_34149271DomainSARAH
TgeneRASSF1chr19:38828144chr3:50369585ENST00000357043-16198_292123345DomainRas-associating
TgeneRASSF1chr19:38828144chr3:50369585ENST00000357043-16294_341123345DomainSARAH
TgeneRASSF1chr19:38828144chr3:50369585ENST00000359365-16198_292119341DomainRas-associating
TgeneRASSF1chr19:38828144chr3:50369585ENST00000359365-16294_341119341DomainSARAH
TgeneRASSF1chr19:38828144chr3:50369585ENST00000395126-16198_292-32190DomainRas-associating
TgeneRASSF1chr19:38828144chr3:50369585ENST00000395126-16294_341-32190DomainSARAH
TgeneRASSF1chr19:38828144chr3:50369585ENST00000327761-05315_31849271RegionNote=MOAP1-binding
TgeneRASSF1chr19:38828144chr3:50369585ENST00000357043-16315_318123345RegionNote=MOAP1-binding
TgeneRASSF1chr19:38828144chr3:50369585ENST00000359365-16315_318119341RegionNote=MOAP1-binding
TgeneRASSF1chr19:38828144chr3:50369585ENST00000395126-16315_318-32190RegionNote=MOAP1-binding
TgeneRASSF1chr19:38828144chr3:50369585ENST00000327761-0551_10549271Zinc fingerPhorbol-ester/DAG-type
TgeneRASSF1chr19:38828144chr3:50369585ENST00000395126-1651_105-32190Zinc fingerPhorbol-ester/DAG-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCATSPERGchr19:38828144chr3:50369585ENST00000409235+2291088_1159901160Topological domainCytoplasmic
HgeneCATSPERGchr19:38828144chr3:50369585ENST00000409235+22936_1066901160Topological domainExtracellular
HgeneCATSPERGchr19:38828144chr3:50369585ENST00000409235+2291067_1087901160TransmembraneHelical
TgeneRASSF1chr19:38828144chr3:50369585ENST00000357043-1651_105123345Zinc fingerPhorbol-ester/DAG-type
TgeneRASSF1chr19:38828144chr3:50369585ENST00000359365-1651_105119341Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for CATSPERG_RASSF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CATSPERG_ENST00000409235_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_312aa
MCGPAMFPAGPPWPRVRVVQVLWALLAVLLASWRLWAIKDFQECTWQVVLNEFKRVGESGVSDSFFEQEPVDTVSSLFHMLVDSPIDPSE
DEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKD
AVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMP

>In-frame_CATSPERG_ENST00000410018_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_312aa
MCGPAMFPAGPPWPRVRVVQVLWALLAVLLASWRLWAIKDFQECTWQVVLNEFKRVGESGVSDSFFEQEPVDTVSSLFHMLVDSPIDPSE
DEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKD
AVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMP

>In-frame_CATSPERG_ENST00000215069_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_328aa
MGRKSKKWGKKVSRYEGKVRLKKVPAKKLVPAWKEKVLWALLAVLLASWRLWAIKDFQECTWQVVLNEFKRVGESGVSDSFFEQEPVDTV
SSLFHMLVDSPIDPSEDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPG
RGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CATSPERG_ENST00000409235_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_936nt
ATGTGCGGCCCAGCCATGTTCCCTGCCGGTCCTCCGTGGCCCAGAGTCCGAGTCGTGCAGGTGCTGTGGGCCCTGCTGGCAGTGCTCCTG
GCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGCACCTGGCAGGTTGTCCTGAACGAGTTTAAGAGGGTAGGCGAGAGTGGT
GTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTGAGCAGCTTGTTTCACATGCTGGTGGACTCACCCATCGACCCGAGCGAG
GACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAGGAGTACAATGCCCAGATCAACAGCAAC
CTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCATCAAGGTTCAGCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGC
AAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCCCAAGGAT
GCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGAGGCCCTGCTGCGAAAGTTCTTGGTGGTGGATGACCCC
CGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAAGTGTACTTGCGGAAGCTGTTGGATGATGAGCAGCCCCTGCGGCTGCGG
CTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCT
GAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCAGAAGTACTCCTATTGCCGCCAGAAG

>In-frame_CATSPERG_ENST00000410018_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_936nt
ATGTGCGGCCCAGCCATGTTCCCTGCCGGTCCTCCGTGGCCCAGAGTCCGAGTCGTGCAGGTGCTGTGGGCCCTGCTGGCAGTGCTCCTG
GCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGCACCTGGCAGGTTGTCCTGAACGAGTTTAAGAGGGTAGGCGAGAGTGGT
GTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTGAGCAGCTTGTTTCACATGCTGGTGGACTCACCCATCGACCCGAGCGAG
GACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAGGAGTACAATGCCCAGATCAACAGCAAC
CTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCATCAAGGTTCAGCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGC
AAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCCCAAGGAT
GCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGAGGCCCTGCTGCGAAAGTTCTTGGTGGTGGATGACCCC
CGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAAGTGTACTTGCGGAAGCTGTTGGATGATGAGCAGCCCCTGCGGCTGCGG
CTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCT
GAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCAGAAGTACTCCTATTGCCGCCAGAAG

>In-frame_CATSPERG_ENST00000215069_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_984nt
ATGGGAAGGAAGAGTAAGAAGTGGGGCAAGAAGGTGTCGCGGTACGAGGGGAAGGTGAGACTCAAGAAGGTGCCGGCTAAGAAGCTGGTG
CCGGCGTGGAAGGAGAAGGTGCTGTGGGCCCTGCTGGCAGTGCTCCTGGCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGC
ACCTGGCAGGTTGTCCTGAACGAGTTTAAGAGGGTAGGCGAGAGTGGTGTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTG
AGCAGCTTGTTTCACATGCTGGTGGACTCACCCATCGACCCGAGCGAGGACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCT
GAGATTGAGCAGAAGATCAAGGAGTACAATGCCCAGATCAACAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTC
ATCAAGGTTCAGCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGA
CGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCCCAAGGATGCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGT
GAAGTCATTGAGGCCCTGCTGCGAAAGTTCTTGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAA
GTGTACTTGCGGAAGCTGTTGGATGATGAGCAGCCCCTGCGGCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTG
AAGGAAAATGACTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCTGAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CATSPERG_ENST00000409235_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_1844nt
GAAGTCGGCTGTGGAAGTGTGGGCGGCCATTTTGAGACCGGGCAAGAGGGGCGGGACTGGTGCGGCCGAGTGACAGTTGACCGGTTTTAA
CCAAGTGACTGGTTCTAGCCACGTTATGTGCGGCCCAGCCATGTTCCCTGCCGGTCCTCCGTGGCCCAGAGTCCGAGTCGTGCAGGTGCT
GTGGGCCCTGCTGGCAGTGCTCCTGGCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGCACCTGGCAGGTTGTCCTGAACGA
GTTTAAGAGGGTAGGCGAGAGTGGTGTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTGAGCAGCTTGTTTCACATGCTGGT
GGACTCACCCATCGACCCGAGCGAGGACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAGGA
GTACAATGCCCAGATCAACAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCATCAAGGTTCAGCTGAAGCTGGT
GCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCG
CACTTCCTTTTACCTGCCCAAGGATGCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGAGGCCCTGCTGCG
AAAGTTCTTGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAAGTGTACTTGCGGAAGCTGTTGGA
TGATGAGCAGCCCCTGCGGCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCTGGGGAGGT
GAACTGGGACGCCTTCAGCATGCCTGAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCA
GAAGTACTCCTATTGCCGCCAGAAGATCCAAGAGGCCCTGCACGCCTGCCCCCTTGGGTGACCTCTTGTACCCCCAGGTGGAAGGCAGAC
AGCAGGCAGCGCCAAGTGCGTGCCGTGTGAGTGTGACAGGGCCAGTGGGGCCTGTGGAATGAGTGTGCATGGAGGCCCTCCTGTGCTGGG
GGAATGAGCCCAGAGAACAGCGAAGTAGCTTGCTCCCTGTGTCCACCTGTGGGTGTAGCCAGGTATGGCTCTGCACCCCTCTGCCCTCAT
TACTGGGCCTTAGTGGGCCAGGGCTGCCCTGAGAAGCTGCTCCAGGCCTGCAGCAGGAGTGGTGCAGACAGAAGTCTCCTCAATTTTTGT
CTCAGAAGTGAAAATCTTGGAGACCCTGCAAACAGAACAGGGTCATGTTTGCAGGGGTGACGGCCCTCATCTATGAGGAAAGGTTTTGGA
TCTTGAATGTGGTCTCAGGATATCCTTATCAGAGCTAAGGGTGGGTGCTCAGAATAAGGCAGGCATTGAGGAAGAGTCTTGGTTTCTCTC
TACAGTGCCAACTCCTCACACACCCTGAGGTCAGGGAGTGCTGGCTCACAGTACAGCATGTGCCTTAATGCTTCATATGAGGAGGATGTC
CCTGGGCCAGGGTCTGTGTGAATGTGGGCACTGGCCCAGGTTCATACCTTATTTGCTAATCAAAGCCAGGGTCTCTCCCTCAGGTGTTTT
TTATGAAGTGCGTGAATGTATGTAATGTGTGGTGGCCTCAGCTGAATGCCTCCTGTGGGGAAAGGGGTTGGGGTGACAGTCATCATCAGG

>In-frame_CATSPERG_ENST00000410018_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_1844nt
GAAGTCGGCTGTGGAAGTGTGGGCGGCCATTTTGAGACCGGGCAAGAGGGGCGGGACTGGTGCGGCCGAGTGACAGTTGACCGGTTTTAA
CCAAGTGACTGGTTCTAGCCACGTTATGTGCGGCCCAGCCATGTTCCCTGCCGGTCCTCCGTGGCCCAGAGTCCGAGTCGTGCAGGTGCT
GTGGGCCCTGCTGGCAGTGCTCCTGGCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGCACCTGGCAGGTTGTCCTGAACGA
GTTTAAGAGGGTAGGCGAGAGTGGTGTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTGAGCAGCTTGTTTCACATGCTGGT
GGACTCACCCATCGACCCGAGCGAGGACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAGGA
GTACAATGCCCAGATCAACAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCATCAAGGTTCAGCTGAAGCTGGT
GCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCG
CACTTCCTTTTACCTGCCCAAGGATGCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGAGGCCCTGCTGCG
AAAGTTCTTGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAAGTGTACTTGCGGAAGCTGTTGGA
TGATGAGCAGCCCCTGCGGCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTGAAGGAAAATGACTCTGGGGAGGT
GAACTGGGACGCCTTCAGCATGCCTGAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCA
GAAGTACTCCTATTGCCGCCAGAAGATCCAAGAGGCCCTGCACGCCTGCCCCCTTGGGTGACCTCTTGTACCCCCAGGTGGAAGGCAGAC
AGCAGGCAGCGCCAAGTGCGTGCCGTGTGAGTGTGACAGGGCCAGTGGGGCCTGTGGAATGAGTGTGCATGGAGGCCCTCCTGTGCTGGG
GGAATGAGCCCAGAGAACAGCGAAGTAGCTTGCTCCCTGTGTCCACCTGTGGGTGTAGCCAGGTATGGCTCTGCACCCCTCTGCCCTCAT
TACTGGGCCTTAGTGGGCCAGGGCTGCCCTGAGAAGCTGCTCCAGGCCTGCAGCAGGAGTGGTGCAGACAGAAGTCTCCTCAATTTTTGT
CTCAGAAGTGAAAATCTTGGAGACCCTGCAAACAGAACAGGGTCATGTTTGCAGGGGTGACGGCCCTCATCTATGAGGAAAGGTTTTGGA
TCTTGAATGTGGTCTCAGGATATCCTTATCAGAGCTAAGGGTGGGTGCTCAGAATAAGGCAGGCATTGAGGAAGAGTCTTGGTTTCTCTC
TACAGTGCCAACTCCTCACACACCCTGAGGTCAGGGAGTGCTGGCTCACAGTACAGCATGTGCCTTAATGCTTCATATGAGGAGGATGTC
CCTGGGCCAGGGTCTGTGTGAATGTGGGCACTGGCCCAGGTTCATACCTTATTTGCTAATCAAAGCCAGGGTCTCTCCCTCAGGTGTTTT
TTATGAAGTGCGTGAATGTATGTAATGTGTGGTGGCCTCAGCTGAATGCCTCCTGTGGGGAAAGGGGTTGGGGTGACAGTCATCATCAGG

>In-frame_CATSPERG_ENST00000215069_chr19_38828144_+_RASSF1_ENST00000327761_chr3_50369585_-_1777nt
ATGGGAAGGAAGAGTAAGAAGTGGGGCAAGAAGGTGTCGCGGTACGAGGGGAAGGTGAGACTCAAGAAGGTGCCGGCTAAGAAGCTGGTG
CCGGCGTGGAAGGAGAAGGTGCTGTGGGCCCTGCTGGCAGTGCTCCTGGCGTCGTGGAGGCTGTGGGCGATCAAGGATTTCCAGGAATGC
ACCTGGCAGGTTGTCCTGAACGAGTTTAAGAGGGTAGGCGAGAGTGGTGTGAGCGACAGCTTCTTTGAGCAAGAGCCCGTGGACACAGTG
AGCAGCTTGTTTCACATGCTGGTGGACTCACCCATCGACCCGAGCGAGGACGAGCCTGTGGAGTGGGAGACACCTGACCTTTCTCAAGCT
GAGATTGAGCAGAAGATCAAGGAGTACAATGCCCAGATCAACAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTC
ATCAAGGTTCAGCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGATGCCCGGCGGGGCCCAGGA
CGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCCCAAGGATGCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGT
GAAGTCATTGAGGCCCTGCTGCGAAAGTTCTTGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCGCGCTGAGCGTCACGGCCAA
GTGTACTTGCGGAAGCTGTTGGATGATGAGCAGCCCCTGCGGCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTG
AAGGAAAATGACTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCTGAACTACATAACTTCCTACGTATCCTGCAGCGGGAGGAGGAG
GAGCACCTCCGCCAGATCCTGCAGAAGTACTCCTATTGCCGCCAGAAGATCCAAGAGGCCCTGCACGCCTGCCCCCTTGGGTGACCTCTT
GTACCCCCAGGTGGAAGGCAGACAGCAGGCAGCGCCAAGTGCGTGCCGTGTGAGTGTGACAGGGCCAGTGGGGCCTGTGGAATGAGTGTG
CATGGAGGCCCTCCTGTGCTGGGGGAATGAGCCCAGAGAACAGCGAAGTAGCTTGCTCCCTGTGTCCACCTGTGGGTGTAGCCAGGTATG
GCTCTGCACCCCTCTGCCCTCATTACTGGGCCTTAGTGGGCCAGGGCTGCCCTGAGAAGCTGCTCCAGGCCTGCAGCAGGAGTGGTGCAG
ACAGAAGTCTCCTCAATTTTTGTCTCAGAAGTGAAAATCTTGGAGACCCTGCAAACAGAACAGGGTCATGTTTGCAGGGGTGACGGCCCT
CATCTATGAGGAAAGGTTTTGGATCTTGAATGTGGTCTCAGGATATCCTTATCAGAGCTAAGGGTGGGTGCTCAGAATAAGGCAGGCATT
GAGGAAGAGTCTTGGTTTCTCTCTACAGTGCCAACTCCTCACACACCCTGAGGTCAGGGAGTGCTGGCTCACAGTACAGCATGTGCCTTA
ATGCTTCATATGAGGAGGATGTCCCTGGGCCAGGGTCTGTGTGAATGTGGGCACTGGCCCAGGTTCATACCTTATTTGCTAATCAAAGCC
AGGGTCTCTCCCTCAGGTGTTTTTTATGAAGTGCGTGAATGTATGTAATGTGTGGTGGCCTCAGCTGAATGCCTCCTGTGGGGAAAGGGG


Top

FusionGenePPI for CATSPERG_RASSF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CATSPERGPAXIP1RASSF1CNKSR1, MAP1B, MAP1S, TUBG1, TUBB, HRAS, RASSF5, RASSF1, DAXX, STK4, SKP2, CUL1, SKP1, AURKA, AURKB, CDC20, DDB1, CUL4A, C7orf25, KCNE3, SUV39H2, BTRC, C8orf33, MDM2, MAST2, SAV1, STK3, LATS1, HUWE1, GSK3B, ID1, KDM1A, SUV39H1, EXOSC8, FBXW11, E4F1, MST1, NDUFV2, ITPRIP, MTHFR, LRP6, SNX27, HIST2H2AB, XPO6, PRKDC, ATR, ATM, CLNK, LATS2, XPO1, RHOU, RHOA, SMURF1, TGFBR1, TGFBR2, ITCH, VAPB, VAPA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CATSPERG_RASSF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CATSPERG_RASSF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRASSF1C0025500Mesothelioma2CTD_human
TgeneRASSF1C0001418Adenocarcinoma1CTD_human
TgeneRASSF1C0005686Urinary Bladder Diseases1CTD_human
TgeneRASSF1C0005695Bladder Neoplasm1CTD_human
TgeneRASSF1C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneRASSF1C0007194Hypertrophic Cardiomyopathy1CTD_human
TgeneRASSF1C0021390Inflammatory Bowel Diseases1CTD_human
TgeneRASSF1C0024121Lung Neoplasms1CTD_human
TgeneRASSF1C0024667Animal Mammary Neoplasms1CTD_human
TgeneRASSF1C0025149Medulloblastoma1CTD_human
TgeneRASSF1C0036323Schistosomiasis1CTD_human
TgeneRASSF1C1449861Micronuclei, Chromosome-Defective1CTD_human