FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5526

FusionGeneSummary for CARD10_POLR2F

check button Fusion gene summary
Fusion gene informationFusion gene name: CARD10_POLR2F
Fusion gene ID: 5526
HgeneTgene
Gene symbol

CARD10

POLR2F

Gene ID

29775

5435

Gene namecaspase recruitment domain family member 10RNA polymerase II subunit F
SynonymsBIMP1|CARMA3HRBP14.4|POLRF|RPABC14.4|RPABC2|RPB14.4|RPB6|RPC15
Cytomap

22q13.1

22q13.1

Type of geneprotein-codingprotein-coding
Descriptioncaspase recruitment domain-containing protein 10Bcl10 binding protein and activator of NFKBCARD-containing MAGUK 3 proteinCARD-containing MAGUK protein 3carma 3DNA-directed RNA polymerases I, II, and III subunit RPABC2DNA-directed RNA polymerase II subunit FDNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptideRNA Polymerase II subunit 14.4 kDRNA polymerases I, II, and III subunit ABC2polymerase (
Modification date2018051920180523
UniProtAcc

Q9BWT7

P61218

Ensembl transtripts involved in fusion geneENST00000403299, ENST00000406271, 
ENST00000251973, ENST00000494166, 
ENST00000407936, ENST00000405557, 
ENST00000442738, ENST00000460648, 
ENST00000488684, ENST00000606538, 
ENST00000470701, ENST00000608713, 
Fusion gene scores* DoF score3 X 2 X 3=182 X 2 X 2=8
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: CARD10 [Title/Abstract] AND POLR2F [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCARD10

GO:0007250

activation of NF-kappaB-inducing kinase activity

11259443

TgenePOLR2F

GO:0006366

transcription by RNA polymerase II

9852112


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-04-1356-01ACARD10chr22

37911980

-POLR2Fchr22

38437075

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000403299ENST00000407936CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000405557CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000442738CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000460648CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000488684CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000606538CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000403299ENST00000470701CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-3UTRENST00000403299ENST00000608713CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-3CDSENST00000406271ENST00000407936CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000405557CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000442738CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000460648CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000488684CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000606538CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000406271ENST00000470701CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-3UTRENST00000406271ENST00000608713CARD10chr22

37911980

-POLR2Fchr22

38437075

+
Frame-shitENST00000251973ENST00000407936CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000405557CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000442738CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000460648CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000488684CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000606538CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-intronENST00000251973ENST00000470701CARD10chr22

37911980

-POLR2Fchr22

38437075

+
5CDS-3UTRENST00000251973ENST00000608713CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-3CDSENST00000494166ENST00000407936CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000405557CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000442738CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000460648CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000488684CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000606538CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-intronENST00000494166ENST00000470701CARD10chr22

37911980

-POLR2Fchr22

38437075

+
intron-3UTRENST00000494166ENST00000608713CARD10chr22

37911980

-POLR2Fchr22

38437075

+

Top

FusionProtFeatures for CARD10_POLR2F


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CARD10

Q9BWT7

POLR2F

P61218

Activates NF-kappa-B via BCL10 and IKK. DNA-dependent RNA polymerases catalyze the transcriptionof DNA into RNA using the four ribonucleoside triphosphates assubstrates. Common component of RNA polymerases I, II, and IIIwhich synthesize ribosomal RNA precursors, mRNA precursors andmany functional non-coding RNAs, and small RNAs, such as 5S rRNAand tRNAs, respectively. Pol II is the central component of thebasal RNA polymerase II transcription machinery. Pols are composedof mobile elements that move relative to each other. In Pol II,POLR2F/RPB6 is part of the clamp element and together with partsof RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplexbinds (By similarity). {ECO:0000250, ECO:0000269|PubMed:9852112}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCARD10chr22:37911980chr22:38437075ENST00000251973-32023_1152331033DomainCARD
HgeneCARD10chr22:37911980chr22:38437075ENST00000403299-42123_1152331033DomainCARD

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCARD10chr22:37911980chr22:38437075ENST00000251973-320138_4562331033Coiled coilOntology_term=ECO:0000255
HgeneCARD10chr22:37911980chr22:38437075ENST00000403299-421138_4562331033Coiled coilOntology_term=ECO:0000255
HgeneCARD10chr22:37911980chr22:38437075ENST00000251973-320567_5742331033Compositional biasNote=Poly-Ser
HgeneCARD10chr22:37911980chr22:38437075ENST00000403299-421567_5742331033Compositional biasNote=Poly-Ser


Top

FusionGeneSequence for CARD10_POLR2F


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CARD10_ENST00000403299_chr22_37911980_-_POLR2F_ENST00000407936_chr22_38437075_+_241aa
MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLARALNPAKLTPTLRQCRVIDEQDEEEVLSTYRFPCRVNRTGRLMDILRCRGK
RGTEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CARD10_ENST00000403299_chr22_37911980_-_POLR2F_ENST00000407936_chr22_38437075_+_724nt
ATGCCGGGCCGGGCGGAGGCGGGGGAGGCCGAGGAGGAGGCCGGGGCCGGCTCGGGGTCTGAGGCGGAGGAGGACGCGCTGTGGGAGCGA
ATCGAGGGCGTCCGGCATCGGCTGGCTCGCGCCCTGAACCCGGCCAAGCTCACGCCGTATCTGCGCCAGTGCCGGGTCATCGACGAGCAG
GACGAGGAGGAGGTGCTGAGCACCTACCGCTTCCCGTGCCGCGTCAACCGCACCGGGCGCCTGATGGACATCTTGCGCTGCCGTGGCAAG
AGGGGCTATGAGGCCTTCCTGGAAGCCCTGGAGTTCTACTACCCCGAACACTTCACGCTGCTCACGGGCCAGGAACCCGCCCAGCGCTGC
TCCATGATCCTCGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAG
CTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAG
GCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCC
ATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGAGGCGGCGGCTCAGAGAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CARD10_ENST00000403299_chr22_37911980_-_POLR2F_ENST00000407936_chr22_38437075_+_955nt
GGCGTGCAGACGGACGCGCGGGGTGGCCGGGGGCCGGACGCACGACCCGGGGCGGGCGGCAATGTGGGGAGGCCCGGGCAGCCCAGGAGG
CTGCGGGGACGGGGGCGGAGCCGGGGGCGCCACGGGCACCGCCCCCCTGCGCCGGCGGAGCCGCCGCCCGAGTGCGGACCCGGGAGCCCG
AGGCGACTGTAGCGTGCGGGACCCTGAGGACACGGCCATGCCGGGCCGGGCGGAGGCGGGGGAGGCCGAGGAGGAGGCCGGGGCCGGCTC
GGGGTCTGAGGCGGAGGAGGACGCGCTGTGGGAGCGAATCGAGGGCGTCCGGCATCGGCTGGCTCGCGCCCTGAACCCGGCCAAGCTCAC
GCCGTATCTGCGCCAGTGCCGGGTCATCGACGAGCAGGACGAGGAGGAGGTGCTGAGCACCTACCGCTTCCCGTGCCGCGTCAACCGCAC
CGGGCGCCTGATGGACATCTTGCGCTGCCGTGGCAAGAGGGGCTATGAGGCCTTCCTGGAAGCCCTGGAGTTCTACTACCCCGAACACTT
CACGCTGCTCACGGGCCAGGAACCCGCCCAGCGCTGCTCCATGATCCTCGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGAC
AGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCG
GGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGA
GCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCG


Top

FusionGenePPI for CARD10_POLR2F


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CARD10BCL10, ATXN7, IKBKG, CARD10, KLHL12, GFOD1, CAPZA2, DBN1, MYO1C, KIF20A, MYO19, CDC5L, FAM167APOLR2FMED10, MED9, MED29, MED19, MED26, POLR2C, POLR2A, POLR2E, POLR2G, POLR2K, POLR3D, MED1, MED30, APP, ESR1, SRC, PSMB9, TCEB3, GPN3, PIH1D1, RPRD1B, POLR2M, CRCP, POLR1A, POLR1C, POLR2B, POLR2H, POLR2I, POLR3F, POLR3K, SUPT4H1, SUPT5H, GTF2B, GTF2F1, GTF2F2, GTF3C1, IL15RA, MAP3K4, POLR2J, SDC2, CTDP1, RECQL5, BAG5, KEAP1, POLR3G, POLR3C, CD3EAP, TRIOBP, POLR3A, GPN1, MAST3, SETX, PLEKHM2, DCAF4, ZNRD1, POLR1D, MED15, DYNC2LI1, POLR3B, POLR3E, BDP1, KDM3A, POLR1E, RPAP2, MED25, POLR1B, POLR3GL, DNTTIP1, GCOM1, POLR3H, LMO2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CARD10_POLR2F


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CARD10_POLR2F


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource